SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000077256 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000077256
Domain Number 1 Region: 118-239
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.04e-22
Family Synaptotagmin-like (S variant) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000077256   Gene: ENSDARG00000059523   Transcript: ENSDART00000082821
Sequence length 269
Comment pep:known chromosome:Zv9:6:52033531:52106624:-1 gene:ENSDARG00000059523 transcript:ENSDART00000082821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSQSRLSLSASFEALAIYFPCMNSFDEDDGDPEGRRLKGIQRSTETGLAVEMPSRTVR
QASHESIEDSMNSYGSEGNLNYSGMCLASDAQFSDFLDGMGPAQFVGRQTLATTSMGDVE
ISLMERSGQLEVEVIQARGLIMKPGSKGPPAAYIKVYLLENGICIAKKKTKSVRKSLDPL
YNQVLVFSESPQGKVVQVIVWGNYGRMDRKCFMGVARILLEELDLSSMVIGWYKLFPTSS
MVDPTMAPLIRHSSQLSLESTVGPCCERS
Download sequence
Identical sequences E7F2S0
ENSDARP00000077256 XP_699547.4.45394 ENSDARP00000077256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]