SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000078496 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000078496
Domain Number 1 Region: 637-1004
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.14e-129
Family Hect, E3 ligase catalytic domain 0.00000000401
Further Details:      
 
Domain Number 2 Region: 20-179
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.84e-27
Family PLC-like (P variant) 0.082
Further Details:      
 
Domain Number 3 Region: 580-619
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000208
Family WW domain 0.00026
Further Details:      
 
Domain Number 4 Region: 201-239
Classification Level Classification E-value
Superfamily WW domain 0.000000000000236
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 400-437
Classification Level Classification E-value
Superfamily WW domain 0.000000000000306
Family WW domain 0.0015
Further Details:      
 
Domain Number 6 Region: 532-568
Classification Level Classification E-value
Superfamily WW domain 0.000000000000846
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000078496   Gene: ENSDARG00000060006   Transcript: ENSDART00000084061
Sequence length 1011
Comment pep:known chromosome:Zv9:21:9424472:9589924:-1 gene:ENSDARG00000060006 transcript:ENSDART00000084061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNFEPIYGLSEDENESRILRVKVIAGIDLAKKDIIGASDPYVKLSLYVADENRELALV
QTKTIKKTLNPKWNEEFYFRVCPQNHRLLFEVFDENRLAHIGLDRPKNGHFNNGQTRDDF
LGQVDVPLTHLPTEDPAMERPYTFKDFLLRPRSHKSRVKGYLRLKMAYLPKNGGHEEESG
EMREEAEGWEVTDSTDPGSQRPQQLLPPLPPGWEEKVDNLGRTYYVNHNNRTTQWKRPSS
VDVVSETENDNQLRQINQEAHRVFRSRRHISEDLENEQLDIRDIDDSWEPISEEDPTLLT
DGLNHSLSGPSSLAMPLSSTPDFSDEISLRLSLAPDTNGEIPGPSSAVQSHLSSRLRSSS
MTDGVSDQAQPPTPTSSQTRRTRAQTVTGVEDTMSPSASYALTTPGLPPGWEERKDPKGR
TYYVNHNNRSTTWTRPILQHTEDGASTSVAAVGGATAATPPASTPSTSSGHLSEPQVRRP
RSLSSPTVTLSSPLEGANNVPIRRAVKDTFSNPQSPQPSPYSSPKTQHKANQSFLPPGWE
MRIAPNGRPFFIDHNSRTTTWEDPRLKYPVHMRTKASLDPGDLGPLPPGWEERVHADGRT
FYIDHNNKKTQWEDPRLQSPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHR
NNIFEESYRRIMSLKRPDSLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFE
YSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLGKQI
TLNDMESVDSEYYNSLKWILENDPTELDLRFCIDEDNFGQTYQVDLKPSGSDMVVTNDNK
KEYIDLVIQWRFVNRVQKQMNAFLEGFTELIPIDLIKIFDENELELLMCGLGDVDVNDWR
QHTVYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQL
FTIEQWGTPDKLPRAHTCFNRLDLPMYETFEDLREKLLMAVENAQGFEGVD
Download sequence
Identical sequences F1Q632
ENSDARP00000078496 ENSDARP00000078496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]