SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000079302 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000079302
Domain Number 1 Region: 47-358
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.89e-47
Family WD40-repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000079302   Gene: ENSDARG00000060320   Transcript: ENSDART00000084867
Sequence length 789
Comment pep:known chromosome:Zv9:13:36810924:36840775:-1 gene:ENSDARG00000060320 transcript:ENSDART00000084867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEARGCSMRSAVGFLSRRTIDGHPQLKEEFQRRRLSGCSSLYKKDMLGHFGCVNAIEFS
NNGGQWLVSGGDDRRVLLWHMEKAIHSRAKPMKLKGEHLSNIFCLAFDSTNKRVFSGGND
EQVILHDVERGETLNVFLHDDAVYGLSVSPVNDNVFASSSDDGRVLIWDTREPPHGEPFC
LANYPSAFHSVMFNPVEPRLLATANSKEGVGLWDIRKPRSSLLRYGGSLSLQSAMSVRFN
STGTQLLALRRRLPPVLYELHSRLPSFQFDNQGYFNSCTMKSCCFAGDRDQYILSGSDDF
NLYMWRIPTDPEAGGAGRVVNGAFMVLKGHRSIVNQVRFNPHTYMICSSGVEKVIKVWSP
YKQPDSLGDLEGLVEDKSRSLYTHEEYISLVLNSGTGLSHDYVSQSVQEDPRMMAFFDSL
VRREIEGWSSDSDSDLSEGAILQLHARARRSTRSTRSTPRSPAAVSAAHHSDSEHSSSSS
LAGPDVSGSERTDQDRSGSQRNRARPRASAFLLDLVNEDSDSSGFWLDPMPRPRSPSPRE
NSSLSSHASSAGVASSSSSSPSSSSSSSSSTDGVDEELRRSRMRQRNAARWRRHIGFSPR
DSAQTLHSATDSSNYPNISIHDQSSPSSSSGDEDRPFRNRGKQKPSPSHLSDRQSQSRCR
RRITSSFSGAGDGPLERAKSRAGFLAESGEELERGRTSGEELSTVEDLNLTLSSRTTVAG
VNGRPHIDENCGDSIHPECSGVELGKSAGDSRTQGEPSEREITSVAGKRTCSDSGDEDDS
PSEKRAKTW
Download sequence
Identical sequences Q08BZ1
ENSDARP00000079302 NP_001071020.1.45394 ENSDARP00000079302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]