SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000079567 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000079567
Domain Number 1 Region: 155-509
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.32e-79
Family WD40-repeat 0.0000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000079567   Gene: ENSDARG00000008966   Transcript: ENSDART00000085132
Sequence length 511
Comment pep:known chromosome:Zv9:2:7553121:7574117:-1 gene:ENSDARG00000008966 transcript:ENSDART00000085132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYV
EAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQVYKDKLAQQQAASASSATTAAAA
KNGENTANGEENGAHTLSNHHSDMMEVDRAVEIPASKAMVLRGHESEVFICAWNPVSDLL
ASGSGDSTARIWNLSESSTGGSTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGTLLATGS
YDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEAKQQF
PFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQERPIKTFQGHTNEVNAIKWDPTGNLL
ASCSDDMTLKLWSMKQDTCVHDLQAHSKEIYTIKWSPTGPGTNNPNANLMLARSASFDST
VRLWDAERGACIHTLTKHQEPVYSVAFSPDGRHLASGSFDKCVHIWNTQSGALVNSYRGT
GGIFEVCWNSTGDKVGASASDGSVCVLDLRK
Download sequence
Identical sequences ENSDARP00000079567 ENSDARP00000079567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]