SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000080641 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000080641
Domain Number 1 Region: 560-679
Classification Level Classification E-value
Superfamily AXH domain 4.58e-42
Family AXH domain 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000080641   Gene: ENSDARG00000060862   Transcript: ENSDART00000086206
Sequence length 827
Comment pep:known chromosome:Zv9:16:27794780:27802591:-1 gene:ENSDARG00000060862 transcript:ENSDART00000086206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSNQERCNECLPPKKREILALEEKQVLVSAAVSESQSGENLAWLASVATMASMAHIPNN
AGPSHSNSSEPDSPPPSNKALTVVAEYPPTTTSAGFSFSSNSSTYRGVLSGPTVLTASPA
VLSTSLPQTIGSVQYTQLPPNLQLIGPYTSYISSHIVPSTSSPTQPQRTPQEILATTAVI
SQASSLDSQSHVISSIPNVSHSQCIQVESAPLGLTVSSPSTQLPLQIHPHSAVLAPHALA
LTPSQVVLHYTDGFIAKQPDSHRREVLNGALGDVTVVKHNTTMAKGISSQPDVEQNHKQN
HNLGIQTQAQVLLPADYTTNDRAGLQTSLMLVSSSHLAANSNSDIQSILGKDHSSLHLAE
RGGICLGKPMSRVSSLTSSDSQVSPASTISPHTLIQAPHNAPQQELSTSLYSATQLPIIG
YITSASGGPQQAVTGYQSNLPQHVVISGNPSLLIPVSATNINPSTAEPEVTRCSVIPSLA
NASTALPQTFINTSPPAAVASVLPNGKDITGSDGGLVPCAVPSPTQIQLPVLSGSVVRSP
VPATPPISTSPHSSPSSPTAGLPPFFMKGSIIQLADGELKRVEDLRTEDFVQSAEVSGEL
KIDSSTVERIEGSGTPNAVIIQFSVGENKAQVCVEVLVEYPFFVFGQGWSSCCPDRTTQL
LALSCAKLSVGDVCISLTLKSLKNSIQKKDHFSDSVMKHSLLNATKNNGPLMERPTQVDD
LKKGHKIPSEVENSIVEKLIETSNTKIVLSLSENGGSNPQTLVNLQNQAEKTYTSTAERP
ISRKRRWSAPEKADMQKSREDPQILPKFSFIPHQLKVSIEGRSSTGC
Download sequence
Identical sequences E7F6Z5
XP_005158216.1.45394 XP_694194.1.45394 ENSDARP00000080641 ENSDARP00000080641 ENSDARP00000124202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]