SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000080759 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000080759
Domain Number 1 Region: 190-502
Classification Level Classification E-value
Superfamily RNI-like 5.34e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.079
Further Details:      
 
Domain Number 2 Region: 123-208
Classification Level Classification E-value
Superfamily F-box domain 0.0000000144
Family F-box domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000080759   Gene: ENSDARG00000060915   Transcript: ENSDART00000086324
Sequence length 505
Comment pep:known chromosome:Zv9:3:28782906:28802535:-1 gene:ENSDARG00000060915 transcript:ENSDART00000086324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLHPREMTQFWSILRLPMLNMSTPSDLKSPCMTRNGMVKLPPQPNRLGSASITKGTPAA
KNRLCQSSSVPTILPPPSLPYHLDPLPTAASLLGPDLDTSPVTAIKPPLRQFPKPLLERQ
LILDEKVLNRLLWYFTTAEKCILAQVCKTWRKVLYQPKFWEGVTPILHAKELYTILPNGE
KEFVSLQAFALRGFQAFCLVGVSDLDICEFIDNYPLSKKGVKSVSLKRSTITDAGLEVML
EQMQGLMHLELSGCNDFTEAGLWSSLNARLTSLSVSDCINVADDAIAAISQLLPNLSELS
LQAYHVTDTAMAYFTAKQGYTTHTLRLNSCWEITNHGVVNMVHSLPNLTSLSLSGCSKIT
DDGVELVAENLRKLRSLDLSWCPRITDMALEYIACDLHKLEELVLDRCVRITDTGLGYLS
TMSTLRSLYLRWCCQVQDFGLQHLYGMRSLRLLSLAGCPLLTTTGLSGLIQLQDLEELEL
TNCPGATAELFKYYSQHLPRCMVIE
Download sequence
Identical sequences ENSDARP00000080759 ENSDARP00000080759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]