SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000082159 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000082159
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.47e-28
Family Canonical RBD 0.00016
Further Details:      
 
Domain Number 2 Region: 397-481
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.13e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 195-270
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 4 Region: 280-357
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 5 Region: 486-579
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000082159   Gene: ENSDARG00000061478   Transcript: ENSDART00000087726
Sequence length 598
Comment pep:known chromosome:Zv9:3:23815586:23866356:-1 gene:ENSDARG00000061478 transcript:ENSDART00000087726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLYIGNLNEKVTAEDLVKTFEDYKIPYSGQFLMKTGYAFVDCPDDQWAMKAIETFSGK
VELHGKRIEVEHSVPKKQRTRKLQIRNIPPHLQWEVLDGLLAQYGTVENCEQVNTDSETA
VVNVTYGTREQARQAIQKLNGYQFDNNALRVSYIPDENSEVDSQRGPDNGRRPGYGPRGT
SRQMSPGSGIPSKHQHADIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENA
GAAEKPISIHSTPEGCSAACRMILEIMNQEAKDTKTADEVPLKVLAHNNFVGRLIGKEGR
NLKKVEQDTDTKITISPLQDLTLYNPERTITVKGSIEACCLAEQEIMKKVREAYDNDIAA
MNQQTHLIPGLNLGAIGLFPPSSAMPPPALGNSVPGPPYGPMGASEQETVHVYIPAQAVG
ALIGKKGQHIKQLSRFAGASIKIAPAEAPDSKMRMVIVTGPPEAQFKAQGRIYGKLKEEN
FFGPKEEVKLETHIKVAAAAAGRVIGKGGKTVNELQNLTAAEVVVPREQTPDEHDQVIVK
IIGHFYASQLAQRKIRDILTQVKQQQKGGGMGTPQGPHPQGMTELGSPQGLAQEPRRK
Download sequence
Identical sequences A0A0B4J1A6
NP_001070027.2.45394 ENSDARP00000082159 7955.ENSDARP00000082159 ENSDARP00000082159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]