SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000082368 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000082368
Domain Number 1 Region: 13-271
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000025
Family WD40-repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000082368
Domain Number - Region: 985-1048,1113-1165,1202-1240
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00115
Family WD40-repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000082368   Gene: ENSDARG00000061570   Transcript: ENSDART00000087935
Sequence length 1536
Comment pep:known chromosome:Zv9:18:39447076:39477737:1 gene:ENSDARG00000061570 transcript:ENSDART00000087935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYGSGCDIVILASDFECVQIIPGAQNGNIQVGCVECSQQLGRIAASYGNTVCIFEPISSN
PNKRHKQLNYQWQKTGQFFLNAITYNLAWDPQGNRILAATERLQLWAPPASDALIEEEDS
QLNDDRALELVLNDWKCVWQCKTAAAILITQWSPDGEYFATIGKDDCLLKVWYPTTGWKS
AVVLPDVTDKKAPAVHFSFVYLAHPRTVTGFSWRKTSKYMPKGSVCNVLLTSCADGICRL
WSETLLPEDSLLGGQISENSTSFSSSLPNMAQKDKIQHALESIHHLKHLRRGRRRSSALV
AHTEVLPSQLGSHETHRHISHHANALCHFHISASINPNTDIPAALAGSGLFSEDASGGFV
VHWLNNKDLSFTTSMDLFMQQLRKLSEQHLEQATEDFEQEGTAKFDFGTALKDLDEMSDK
GSSEHEEGDQEGSTKASSPGSSSSVPLPSVLLDRKLETLILEWNKSPDMLFTIHPHDGSF
LVWHVKYLDEFIPGIFRQVQVSFSSRIPVAFPTGDANSLSKNIMMYACTFMDQDSCSALE
EKRSERRVPQSASASAGLSSLGHSLAAVIGPAVMMVSKHVDGSLNQWAVTFAEKSAFSNV
LTVSHKFRYCGHRFHLNDLACHTVLPLLLTSSHHNALLTPPSGSGSIDGDLIGGVAQQPT
RPMRGIPRKQLRNAATRTFHDPNAIYSELILWRVDHIGPLSCTGGVSELARINSLHTSAF
SNVAWLPTLIPSSVLGTYCNSASACFVASDGKNLRLYQAVVDARKLLDELSDPETSKLVG
EVFNIVSQQSTARPGCIIELDVITNQCGSNTQLLHVFQEDFILGYKPHEDIPDFNINSFP
SGEEHYIWVVFVVDYQPPPFSEKFYLVVIEKDANRNSVLQMWHLHLRSVQACVEEPVNDY
MFQNQLTVPLSQTNADSSPDITPGHSPLPRSSSSANLQSASKLILSSKLVYSQRLDLPPG
VELIRATPSAGHLSSSSIYPVCLAPYLIVTTCSDGRVRFWHCRVDMDLSAPQPEETHSYR
WEHWSLLKEEEDNDSSVCVAGRPVAVSCSYTGRLAISFKQISPASEGGLSQDFSMLVSIY
ECESTGGSEWVLEQTIHLDDFSKPAKTLDPRVSVDSNLFVYSKSDLFVTKDSPNIKHFVH
LDWLSKEDGSHILTVGVGSNILMYGRISGIVTEQTGVKDGMAVTLPLGGSIKQGIRSRWV
LLRSVNLVSSVDGTPSLPVSLSWVRDGILVVGMDCEMQVYAQWRQEEKLGDSEDNSISSP
EGIGGRTVSVSHEGRARSKSVFEGSAGIDDALRPPAVIQDGGLFEAAHSLSPTLPQYHPT
QLLELMDLGRVRRAKAILAHLVKCIAGEVAVVRDVEAGEGGARRHLSRTISVTGSTAKDT
IVAGRDGGRDYTEINSIPPLPLYALLSADQETSYKAKWGRGDGEEVAKTGKGMDRDIQKQ
PEDHYADLFQVQSVTTDDFVSFATEKPEKKSRVINLSQYGPTYFGPEHAQVLSSHLMHSS
LPGLTRLEQMFLVALADTVATTSAEVAGPTDKQYTG
Download sequence
Identical sequences ENSDARP00000082368 ENSDARP00000082368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]