SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000082675 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000082675
Domain Number 1 Region: 109-202
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.84e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 866-926
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000444
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number 3 Region: 280-351
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000126
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000082675   Gene: ENSDARG00000061682   Transcript: ENSDART00000088242
Sequence length 964
Comment pep:novel chromosome:Zv9:17:20816372:20879078:-1 gene:ENSDARG00000061682 transcript:ENSDART00000088242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMAEPLSFMHHDHGSSSERSDDSPSAVSEDDSSGHCGHISPPDPDWTEERFRVDRKKLET
MLLAANEGRINGDDFFQKVMDETNTQIAWPSKLKIGAKSKKDPHIKVSGKRDDVREAKEK
IMSVLDTKSHRVTLKMDVSHTEHSHVIGKGGHNIKRVMEETGCHIHFPDSNRHSQAEKSN
QVSIAGQLTGVEAARVKIRELLPLVLMFECSGVVQLVDCSSPVVQHISHTYNVSISFRPP
SRLYGNTAIVRANQNNSSGVKRGTALLLEHLAGSLASSVMVSTQLDIAPQHHHFLLGRNG
ANIKLISQRTGAHIHFPEISPHNSNASRSAVYIQGSIDAVCAARQQIMGCLPLVLLFDIK
EETEVASQVITTLMEQLDVFISIKPKPKQPSKSVIVKSVERNAGSLYEVRRILLGLESSC
LSSSVSSVSVNGHISSSPPRIASIGLDTLASAGLRLSTLGNVGKRIIRINSKSIQNSLAD
LLRSSVSPVPNGSPNPSSLWASALSSAADAAGKCACFYLMLQSVSQATLGGLLLSGVQSQ
AHTHTPSLPPGLAPIHKTVSAEHLNGHVRKPLLLLHTRISSVSLNSAHCDTAQEGIGHTQ
SEAKSTDEGISDTFVEVGMPRSPSHSANGSELKQMLASCTVSPGKRQTVELLQRTKNTLL
HSVECVLADSDDNPMTDKRAPGSERAAERRLAPHMQVYMLMCKHCTHNSAQAFDYEKKKL
LATKAMLKKPVVTEIRTPTNTWSGLGFSKSMPAESIKELRRAHHVPYKPSMGTTYEDSHL
SMSHSGIQEGLINDTKSDNWGDLNGNVNINGNGPSGNSEFSQTVSSPKRIKNKSLGEQYL
SSSNYMDSISLTGSNGISLSSSLKGTDLPELFSKLGLGKYTDIFQQQEIDLQTFITLTDP
DLKELGITTFGARRKMLLAISELNKSRRKLFDTANIRSSFLEGGASGRLTRHFHSDMTSV
SGRW
Download sequence
Identical sequences ENSDARP00000082675 ENSDARP00000082675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]