SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000084255 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000084255
Domain Number 1 Region: 181-480
Classification Level Classification E-value
Superfamily RNI-like 3.14e-43
Family Cyclin A/CDK2-associated p19, Skp2 0.0078
Further Details:      
 
Domain Number 2 Region: 111-158
Classification Level Classification E-value
Superfamily F-box domain 5.23e-16
Family F-box domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000084255   Gene: ENSDARG00000062251   Transcript: ENSDART00000089822
Sequence length 489
Comment pep:novel chromosome:Zv9:2:21430651:21531256:1 gene:ENSDARG00000062251 transcript:ENSDART00000089822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGANNGKQSGSEGKGSSSISSDLSSSTDQTSTKAPKNAATSEDSDLSMRTVSTPSPALIL
PPRSSSAVLNGSSTSSSTFGTETIAMVHMPPTSLTHPQRCLRQPRDQQGAPVDILPDHAF
LQIFTHLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGDVLHVDRALRVLTRRLCQDTP
NVCLTVETVMVSGCRRLTDRGLYTVAQSCPELRRLEVAGCYNVSNEAVFEVVSRCPNLEH
LDVSGCSKVTCISLTRDVSVKLSPLHGQQISIRFLDMTDCFALEDEGLHTIAAHCTQLTH
LYLRRCVRLTDEGLRFLVIYCPGVRELSVSDCRFISDFGLREIAKLEGRLRYLSIAHCSR
ITDVGVRYVAKYCSRLRYLNARGCEGLTDHGIEHLAKSCLKLKSLDIGKCPLVSDAGLEQ
LALNSFNLKRLSLKSCESITGRGLQVVAANCFDLQLLNVQDCDVSLEALRFVKRHCKRCI
IEHTNPAFF
Download sequence
Identical sequences A1A5X2
7955.ENSDARP00000084255 ENSDARP00000084255 ENSDARP00000084255 NP_001073511.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]