SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000084929 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000084929
Domain Number 1 Region: 952-1154
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000178
Family WD40-repeat 0.017
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000084929
Domain Number - Region: 489-541
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00183
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000084929   Gene: ENSDARG00000062531   Transcript: ENSDART00000090496
Sequence length 1311
Comment pep:known chromosome:Zv9:3:15512054:15593323:1 gene:ENSDARG00000062531 transcript:ENSDART00000090496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMELDEVVYQDDYGAVSVMSERVTGLASSIYQEFERLIKTYDEEVVKELMPLVVNVLENL
DSVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEADKKDLQTTV
ETLELQAKQLELKSKNYADQISRLEERESDMKKEYNALHQRHTEMIQTYVEHIERSKLQQ
SGSNQSESTGCGRSQRHNWRKSKTERPPSLSLYPGGDGMEDGSDSDSVAATPSSTGSKSN
TPTSSVPSATVTPLNDGLVSVGEYDTSRGRARDRRTGKRLSRNMEVQVSQETRNVSIGMG
SSDEWSEFQEIIDSTPELDMCLDPRIFGGGNSPSQGIVNEAFGINTDSLYHEIKDAKSDI
IGDVDAGAELLGEFSVRDDFFGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSS
EQEVLREELESVKQSKTKVDQRVKELEEELKRLRAEALGASQDSKDEGGEDYSSPLQDDV
TMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPPLPEKKKSIIWQF
FARLFSSSASPPPVKRPYTSVNIHYKSPSPAGYNQRRSQTMCQISTSTCIREFLPEEMPV
NGVASLLSDSALCTRREQRREQYRQVREHMRRKDGPMQTCGWSVPSRLKQNGCQADSAPD
ATAKRNQATEKEDNRMKNVPVPVYCRPLVEKDPNRKLWCAAGVDLTGWKTSSQEAASVKP
SNGSDPLTAENEGGDGKSEQSSPEKKKPKELHETDPVSSRVWILTSTHSASKVVIIDANL
PCSLVDQFNVCNAHVLCISSVPAASESDYPAGEIFLEQQAGDGASEEKGGVEGMLAGITI
VGCATNCSVVRSNCSSRTDTPVQDRSNAPTAPVCRSLAVSQSAEEATEAIEVTEEAGPSE
NADSTLGSFTEHVFTDNTHSEPGVAKEKVSSAPADSEEAADERAGTSAAPTMWLGAQNGW
LYVHSAVSNWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRSEDGQWDLSNYHL
MDLGRPHHSIRCMAVVHDKVWCGNKNKIHVIQPKSMQIEKSFDAHPRKESQVRQLAWIGD
GVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIGGNRLWV
GTGNGVIISIPLTETVVLHRGQLLGLRANKVSPTSSGGVIHVYADDSTSEKSSFIPYCSM
AQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSESQGSSAPAETEAQSLQNVLVLS
GGEGYIDFRIGDGEDDETEEADDDEAPQMKPALSKAERSHIIVWQVSYVPE
Download sequence
Identical sequences ENSDARP00000084929 ENSDARP00000084929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]