SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000086213 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000086213
Domain Number 1 Region: 409-443
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000209
Family CCCH zinc finger 0.0022
Further Details:      
 
Domain Number 2 Region: 8-58
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000324
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000086213   Gene: ENSDARG00000063050   Transcript: ENSDART00000091780
Sequence length 1038
Comment pep:known chromosome:Zv9:10:9692072:9733307:1 gene:ENSDARG00000063050 transcript:ENSDART00000091780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVQAAQWTEFLSCPICYNEFDACSHKPISLGCSHTVCKTCLHKLHRKACPFDQTAISTD
IDVLPVNCALLQLVGVPVPEGEVVSVGNAEDTRHYEVCRMCVEELALYLKPVSGGKGELV
KTETQLSRPMQRKLVTLVNCQLVEEEGRVRAVRACRSLGERTVTELILQHQNPQQLSANL
WAAVRARGCQFLGPAMQEDALKLVLLALEDGSALSRKVLVLFVVQKLEARFPQASKTSIG
HVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDAQIVHIAMEAGLRISPEQW
SSLLYGDLTHKSHMQSIIDKLQSPESFAKSVQELTIILQRTGDPANLNSLRAPLELLAGI
DHNPVDAAAPSWPELESVLLAVKVVVHGLVEFIQNFSKKSNESPQAQPNSKYKTSMCRDL
RQQGGCPRGASCTFAHTQEELEKWHRMRNRKASGAVRPFLSVPAVMAKSCTKAGSEVGPG
GIKNHEKDASEDVSPTQLIPRGGDQQEDKMLLSGVNGLHVTSLEQDSMNINNLGSHSQSP
SISSVMSTDRHGHVQMRAHPEYCSQDQRPYELTPYPQSTSMSQTSPRGVITPLNFMIYYW
GFPPTVPPKSCSPRFHRSSNVPESMLPPSVGPVYPDQHPSVPALDRLGPSHFGPPSAYSS
HGMYTPVYDSRRVWRPPLYPRDGGRSNSLPLEVFRSTVYQPPLRERYNSLDSPYCSTTEQ
RATMHSSHKKVKDAYTRVDELYRHKQEHWVHHHSNVNRASQSSPVFTVDMCPEHPEGVGG
GRMTCKCHGGEESLAHYSPWSCSTISPCMNAIYTSPKECDMLSNLCLIICPQEEESGGKR
WLHVLEPYRRLKEEDPIIPFGEGPIISKWGAISRASRTGFHTTDPVQATASQGCTGTTSI
NFSDYGCHIGHSDLRWGPRSSDSSTHSSFLERYQFRLCFLSSHSHFITKQFLPSPLLHLK
NNQICSTEERNSRLGLFQSSVCLCFSDHLAVSGLHARRTSFSSGTKQGLDLMGKDETENE
TDRDIELELSALDIEDTE
Download sequence
Identical sequences ENSDARP00000086213 ENSDARP00000086213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]