SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Danio rerio 69_9 > ENSDARP00000087738

Domain assignment for ENSDARP00000087738 from Danio rerio 69_9

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSDARP00000087738
Domain Number 1	Region: 166-307
Classification Level	Classification	E-value
Superfamily	PH domain-like	1.66e-40
Family	Third domain of FERM	0.00056
Further Details:

Domain Number 2	Region: 67-168
Classification Level	Classification	E-value
Superfamily	Second domain of FERM	1.57e-24
Family	Second domain of FERM	0.00026
Further Details:

Domain Number 3	Region: 3-64
Classification Level	Classification	E-value
Superfamily	Ubiquitin-like	2.27e-19
Family	First domain of FERM	0.0022
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSDARP00000087738 Gene: ENSDARG00000063695 Transcript: ENSDART00000093306
Sequence length	314
Comment	pep:known chromosome:Zv9:9:1177718:1186337:1 gene:ENSDARG00000063695 transcript:ENSDART00000093306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	RSSGRVLFDMVCLHLNLVEGDYFGLQFHNHHRKMVWLDLLKPIRKQITRKTNTVLRFIVK FFPPDQSVLLEELTSRYLFALQVRQDLGSGRLTCSDSSAALLVSHIIQSEIGDFEETQCR QHLLNTNYMPDQMALMDKIMEFHLKHKGQTPAESDYRLLELACRLEMYGIRLHPAKDREG NKVSLSVAHGGVLVFQGHNRINSFNWSAIRKLSFKRRRFLIKLRADPTQNVSPDTLEFLM ASRDCCKMFWKISVENHAFFRLFEEPRPKPKAVLFSRGSSFRFSGRTQKQVIDYVKENEF KKLPFDSLTLNLKL
Download sequence
Identical sequences	ENSDARP00000087738 ENSDARP00000087738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]