SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000088454 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000088454
Domain Number 1 Region: 145-229
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00089
Further Details:      
 
Domain Number 2 Region: 411-481
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.21e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000178
Further Details:      
 
Domain Number 3 Region: 57-134
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.01e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000088454   Gene: ENSDARG00000020178   Transcript: ENSDART00000097684
Sequence length 495
Comment pep:known chromosome:Zv9:5:38211291:38226809:1 gene:ENSDARG00000020178 transcript:ENSDART00000097684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAGGEVQQNGIFSTPQHLSQSPQMDPDLSDSRKRPLETPTEASSTKRSNTGEEGEYFLK
VLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTVEALNGVH
NFIAEKVREMPQSSQKTEPVSILQPQTTVNPDRIKQAKLIVPNSTAGLIIGKGGATVKAV
MEQSGAWVQLSQKPEGINLQERVVTVSGEPEQNRKAVEIIVQKIQEDPQSSSCLNISYSN
ITGPVANSNPTGSPFANSTEVLPNAAAAATASTLLGQAGLAGMGGFPAAMSSLSGNDLLA
ITSALNTLASYGYNTNTLGLGLNPAAASGVLAAVAASANPAAAAAANLLATYASEASGGG
GHPAAPSLGGFSLGSLAAATGASNGYLNPSSPLVASSLLGTEKLAEGGKEVVEIAVPENL
VGAILGKGGKTLVEYQELTGARIQISKKGEFIPGTRNRKVTITGSPAATQAAQYLISQRI
TYEQGVRATNPQKVG
Download sequence
Identical sequences Q1LYC7
ENSDARP00000088454 NP_001038254.1.45394 7955.ENSDARP00000088454 ENSDARP00000088454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]