SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000088691 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000088691
Domain Number 1 Region: 350-419
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.77e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000194
Further Details:      
 
Domain Number 2 Region: 114-194
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000774
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 3 Region: 38-113
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000088691   Gene: ENSDARG00000018914   Transcript: ENSDART00000097919
Sequence length 429
Comment pep:known chromosome:Zv9:8:52006517:52024948:-1 gene:ENSDARG00000018914 transcript:ENSDART00000097919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPENDPQEEETFSNKESNGKRSADDSEEEKPYKRSRNSDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNATVSVPDSSGPERILSVSADIPTVAEILLKIIPTLEEYQHHKGVDFD
CELRLLIHQSLAGSIIGLKGAKIKELRDSTQTTIKLFQECCPQSTDRVVLVGGKAERVVQ
CIKTMLELIVEAPIKGRAQQYDPNFYDETYDYGGFGVMYEERGRRPMGGFSSRGRSSSGG
FDRMPSGGRGGGHHMQSRRDYDDISPRRGPPPSQRGGGRGPRPPRNMGPPHHRRSDDQYY
SSQRGHMDERRHGERRGRNDRYGGSMNDGYDSNSSWDSSYQSGGRSSYSDGPVITTQVTI
PKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLQGSEDRIITITGTQDQIQNAQYLLQNS
ALHLLGRQN
Download sequence
Identical sequences F1QWB4
ENSDARP00000088691 ENSDARP00000088691 NP_998159.2.45394 XP_009302555.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]