SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000088708 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000088708
Domain Number 1 Region: 69-200
Classification Level Classification E-value
Superfamily Bromodomain 3.66e-31
Family Bromodomain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000088708   Gene: ENSDARG00000060578   Transcript: ENSDART00000097935
Sequence length 222
Comment pep:known chromosome:Zv9:5:34818166:34833159:-1 gene:ENSDARG00000060578 transcript:ENSDART00000097935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLAARCNAGLLILSPPDWSQPGDPAGESQAIHNGVSEVMEEESNLKKRKSEQQGNQGS
ETGQEGVEKVKKRRGRPPAEKLPPNPPKLTKQMNTIVDMVINYKDTLGRQISKGFVQLPS
RKEVPEYYELIRKPVDFRRIRERVRNHKYRCIADLEKDIMQMCHNAQTFNLEGSQIFEDS
IVLKSVFESARQRIVELSEEDNDAVGSSEADGSHHLDIKGKS
Download sequence
Identical sequences ENSDARP00000088708 ENSDARP00000088708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]