SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000089186 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000089186
Domain Number 1 Region: 165-238
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-25
Family PHD domain 0.0000262
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000089186
Domain Number - Region: 33-111
Classification Level Classification E-value
Superfamily Ribosome recycling factor, RRF 0.00275
Family Ribosome recycling factor, RRF 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000089186   Gene: ENSDARG00000068175   Transcript: ENSDART00000098415
Sequence length 239
Comment pep:known chromosome:Zv9:2:36326839:36329489:1 gene:ENSDARG00000068175 transcript:ENSDART00000098415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKGMYLEHYLDSIEGLPCELQRNFSLMEDLDKRTEAKKAEISELASEYIEKVKNLASEE
RVQHLKKIDSAYNKCKEFSDDKVQLAMQIYEMVDKHIRRLDAELARFENDLQEKLDSGSQ
DSSDEKQSRKDKNMKDKRGSHARDKKASDQDSPKQKKMKNGPNISESLLAMHPSDVLDMP
VDPNEPTYCLCSQVSYGEMIGCDNSDCPIEWFHFACVGLATKPKGKWYCPRCTQDMKKK
Download sequence
Identical sequences Q7T181
ENSDARP00000089186 ENSDARP00000089186 7955.ENSDARP00000089186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]