SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000090075 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000090075
Domain Number 1 Region: 368-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-55
Family SPRY domain 0.00017
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-20
Family RING finger domain, C3HC4 0.0076
Further Details:      
 
Domain Number 3 Region: 138-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000397
Family B-box zinc-binding domain 0.00064
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000090075
Domain Number - Region: 242-276
Classification Level Classification E-value
Superfamily MIT domain 0.0549
Family MIT domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000090075   Gene: ENSDARG00000026704   Transcript: ENSDART00000099302
Sequence length 550
Comment pep:known chromosome:Zv9:15:40278232:40282404:-1 gene:ENSDARG00000026704 transcript:ENSDART00000099302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESSSSQYVDQFSCPVCLDLLKEPVTIPCGHSYCMSCITDCWSLKEQGPPYRCPQCRES
FSQRPLLKKNTLIAEMMETLQKTALQTPAAAAAAVDCDVCTTEKNRAVKSCLQCLASFCQ
THLQLHYESPAFMKHKLVDASRHIQENICPSHGRPLEIYCQDDHQCICYLCMVDSHKTHS
VVSVDSEWTSKKNVLEEMNLTCVKLIKEREKGQRQLRTATKHLKSSAEEAVERMEKVFTE
LICSLEKKRSEIKEQIRAQEKTETDRAEQLHQHLHQELTQLRKTQAEIHKLLTTEDHIHC
LKSCESVCVLPTFEDVPSFTSHTHLSFKDLSISAFREALEDACRQQTDTFSQEVSNVHVV
KPPEPMTYNQFLCYFYQPHLDPNTAHKNLILSEENRRISYSDTDQQYPDHPERFAVYCNV
LCKEGLTGRCYWEVECSGKKWAVAVSYKGISRKGNTDDSRLGYNKQSWRLSCFKENVFFK
HDSEVVSVPVFDSSRIGVFLDHRAGILSFYSISDTMTLLHRVQTSFTEPLYPAFGLLEGS
IRIIEQRKCL
Download sequence
Identical sequences F1R9Z3
ENSDARP00000090075 NP_001007388.2.45394 ENSDARP00000090075 7955.ENSDARP00000090075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]