SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000090378 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000090378
Domain Number 1 Region: 14-62
Classification Level Classification E-value
Superfamily MIT domain 0.00000144
Family MIT domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000090378   Gene: ENSDARG00000068782   Transcript: ENSDART00000099604
Sequence length 567
Comment pep:known chromosome:Zv9:10:35912766:35930915:-1 gene:ENSDARG00000068782 transcript:ENSDART00000099604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTPEPAEIRVIRENYDKALQCLNTGLQLDEAGNKDQALVLYRLGRRHLLSGLQVDTRGG
RCTGRCWDSARQTQLKMGETLRTITARLGALESASNTGQRLYPTLPVFQDKNSQRAFNSR
GASGRAPSRPVSPPVGFAVPNELPPAYTPQPTDGHLSLSHGANRAFPDAPHQGSRRQAVA
PVNLREAGMEIMFLPSGVQMFFVSAEGRVTAPSYPGYLRIIIYSQDSDGSANTGYAPAYL
QVCDWIYPLYPDFPVLLSNNGVFTFPDTTAAVPGSYVGVVLSSDLPAGERDLFQEQLSVL
AQLRVQVDEEGGGATGADTNLSEKIPLSEASQTPEEKTAPVWSEKMSQSILAGSSWLGRG
LVRGAEATGKAIQRGGTKLRDNITPEETPAEVSPKVTKGLNAAKQATGGAVKVSQFLVDG
VAAVAGKVGKELAPHVKKHGCKLIPESLKKGKDGSSKMDGAKLVAGSSIQGLSTLWSSLE
TAGKTIGKSLSSETVTTVRHKYGDEAGQAADTAVQSTVNVGVTAFNMDNVCLKGVLKATG
KQTTKEIVKDTPKGEKTEDKDKSPKKR
Download sequence
Identical sequences A8WFZ3
NP_001107130.1.45394 ENSDARP00000090378 7955.ENSDARP00000090378 ENSDARP00000090378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]