SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000090528 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000090528
Domain Number 1 Region: 12-87
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000374
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 288-333
Classification Level Classification E-value
Superfamily RING/U-box 0.000000373
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 223-260
Classification Level Classification E-value
Superfamily SAP domain 0.0000641
Family SAP domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000090528   Gene: ENSDARG00000056244   Transcript: ENSDART00000099755
Sequence length 339
Comment pep:known chromosome:Zv9:21:24333337:24339989:1 gene:ENSDARG00000056244 transcript:ENSDART00000099755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAYTNSGSSPLPAPPEHLCKACGGQFDTVRTHVCVDCKNSFCGRCSVQADLHPRMCFTCQ
RLHCTFFERADLMRLKVKDLRDYLHLHQTPTQMCREKEELVELVLDQQAPRGSSGGGAQS
RSQPSQPPLAESEAFLKSPHTVVKSQNVGFSEHCQIFSITTVLLDKKSFSQQLFSQHQRG
KCYLKSRNQIESDSKLCLMQSTDSEETLVHSRRASLSDLSSVEDIEGLSVRQLKEILARN
FVNYQGCCEKWELMEKVTHLFNDQKDLHNLVSNTNTEAADPAEPSGQEENLCKICMDSPI
DCVLLECGHMVTCSKCGKRMNECPICRQYVVRAVHVFRS
Download sequence
Identical sequences ENSDARP00000090528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]