SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000090548 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000090548
Domain Number 1 Region: 73-147
Classification Level Classification E-value
Superfamily F-box domain 9.94e-20
Family F-box domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000090548   Gene: ENSDARG00000068884   Transcript: ENSDART00000099775
Sequence length 348
Comment pep:novel scaffold:Zv9:Zv9_scaffold3564:130269:137112:-1 gene:ENSDARG00000068884 transcript:ENSDART00000099775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTKLSTWTPLNHQLSNAHVFEERRNLLGKWFEKWTDSQRKQVLQDFFSRCSAGQLKHLR
QTLSSWVPEETLDFTTVLPRVISLYIFSYLDPRSLCRCAQVSWHWKNLVELDQLWMPKCL
KLGWCITFTPTPFEQGVWKRQYIETVQELHISRPKVPVKEEFIVPDVKVIGSETEGSLPL
TGHRDLLGLHGRSKNGNDLGKSAKGLPPWRDSDRHPTDTIRFNYLDNLHSGEHARKALLK
TRQEDTIKAPSHSTYKLRKAKSLMFLSLDLSTAGKPSHNRPKWAARNLEALPADKDSIKR
ISQTSQWNAGIRPGPVRPPVPRLSKEGFRASQRSHRSTPTVTLFEGQP
Download sequence
Identical sequences ENSDARP00000090548 ENSDARP00000090548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]