SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000090686 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000090686
Domain Number 1 Region: 137-710
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.84e-166
Family Lysophospholipase 0.0000000000000776
Further Details:      
 
Domain Number 2 Region: 10-121
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.85e-24
Family PLC-like (P variant) 0.000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000090686   Gene: ENSDARG00000024546   Transcript: ENSDART00000099913
Sequence length 741
Comment pep:known chromosome:Zv9:2:20721899:20753362:1 gene:ENSDARG00000024546 transcript:ENSDART00000099913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNIIVEHQYSHRLKLTVVRAENVTKGAFGDLLDTPDPYVELSVPTTPESRKRTRHINND
INPKWNETFEFILDPNQSNVLEVTLMDANYVMDETLGTAKYSLSKLKVAQMEHVTLSIGK
TTKVFLDLLLEVCASTDLRFSMTLCDQEKLFMQTRRDRVMLSIKKLLKMENPRFLPSSPR
EVPTIAILGSGGGFRAMVGFSGVMKALYESGVFDCATYVAGLSGSTWYMSMLYSHPEFPA
KGPGDINKELMNRVSNNPLKLLLPQNINRYVKALWKKKSAGQPVTFTDIFGMLIGETLIP
GRMDIKLSSLKGKINEGQSPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMSP
GLFGSKFFMGSVVKQYEENPLHFLMGVWGSAFSILFNRVLGVKETTSSSTMEEELEQIKP
EHIVGDDSADNEEETQRGGTESADAEDERQRHAQASWVQRMLTSIMGDTTLFTTREGRAG
KVHNFMLGLNLNSTLPFSPFSGITHQTSLEEEVDAVTDPDEFERIYEPLDVKSKKIHVVD
SGLTFNLPYPLILRCQRGVDLIISFDFSARPSDSSPPFKELLLAEKWARMNKLPFPKIDS
KVFDREGLKECYVFKPAKGDKNCPTIIHFVLANINFRNFKAPGVPRDSDKDIEFGDFDIF
DEPASPYSTFNFKYNNQAFKRLHDLMEFNTLNNIEVIKEAIKDSILLRRENPARCSVSLS
LSEIENKKFLKRDNSIAKRPT
Download sequence
Identical sequences F1QWF8
7955.ENSDARP00000038013 ENSDARP00000090686 ENSDARP00000090686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]