SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000090749 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000090749
Domain Number 1 Region: 96-176
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.78e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 9-76
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000526
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000090749   Gene: ENSDARG00000068971   Transcript: ENSDART00000099977
Sequence length 399
Comment pep:known chromosome:Zv9:5:7176108:7180791:1 gene:ENSDARG00000068971 transcript:ENSDART00000099977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRKSVNTTECVMVPTSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKED
VVMAKREILSAAEHFSLIRATRNKAAPNVGHNSVPCHPGQTTIQVRVPYRMVGLVVGPKG
ATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEAHIAMRTAGSVETNVDDD
DFHYNGTDVGFESGSSGAWLFSGGISKFANGSFNSNAAGYRNDSSSSLGSNSSESYFSGK
GSGVADLSPGSTGGTFWFGDTQLPLGSEDSLGYDGLMMTAPSTNAQPALWSTFERGGASL
PTTPRLSPSRLSPSFPEALDHPLVRLVQENSQSLPAFGPAFSPSSADSTGSSSPPDVHNY
TKHSQIPACVRCGEKVPALVLGGQNRICLECSNSILQSE
Download sequence
Identical sequences ENSDARP00000090749 ENSDARP00000090749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]