SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000091471 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000091471
Domain Number 1 Region: 44-364
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.41e-54
Family WD40-repeat 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000091471   Gene: ENSDARG00000069283   Transcript: ENSDART00000100698
Sequence length 400
Comment pep:known chromosome:Zv9:8:17257721:17276685:1 gene:ENSDARG00000069283 transcript:ENSDART00000100698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSFLYARQTGLDDPVRLRRAESTRRVLSLELNHNRDVDRIHGNGINTLDIEVIDGRYML
SGGSDGVIVIYDLENNSKKPQYTCKAICTVGRSSRHVHKFSVETVQWYPHDTGMFVSSSF
DKTMKVWDAETLKPADEFQFDGNVYCHHMSPIARKHSLVAVGTKDPKVQLCDLKSGSRIH
ILQGHRGEILSVKWSPRYEHILATASTDSRVRIWDVRRASGSLFTLDQHNGDKSKASSEA
VNTAHNGRVNGLCFTADGLHLLTTGTDDRMRLWNSGTGENTLVNYGKVVNESRKGLKFTV
SRGCSPEFVFVPCGSSVAVYGLHSGELITMLRGHYNNVDCCEFHPDYQELYSGGKDCNIL
AWVPVLRQPDVDDEETNTKRGGTQAAINPAFADAWSSDED
Download sequence
Identical sequences A9C3R3
7955.ENSDARP00000091471 ENSDARP00000091471 ENSDARP00000091471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]