SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000091564 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000091564
Domain Number 1 Region: 16-103
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000012
Family F-box domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000091564
Domain Number - Region: 117-281
Classification Level Classification E-value
Superfamily RNI-like 0.000228
Family Rna1p (RanGAP1), N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000091564   Gene: ENSDARG00000069328   Transcript: ENSDART00000100791
Sequence length 374
Comment pep:known chromosome:Zv9:18:20882546:20886679:-1 gene:ENSDARG00000069328 transcript:ENSDART00000100791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQRKRALVPVNTRRRAKADDDYFPFNSLPVECQLHVLSFLSEVDKCNSALVCSSWSCLV
RSGKLWRVADYSRRGVFHLGQEGLLVSNREFERWKSWVHHYTHHLISRGASLLTLKASFD
LGDQCNKWGELLSHLLENVHCRDLSHLDLNWTFTLLEPLDLRVHTSSSSHQDNITKMDQV
NNFQILLARLVHSCPRITKMRLHFDWSETSVALITQFQHLRILELKYFWVFKGVSPNTLQ
TVTKSLPNLKSLTLHVLVPLRNLGISYTLESLSLEFLDVSPSRGLVFSRLNLPALRELRA
KKIVRGITLDRRTRLRIQSRWPCLYQVLREGTPKLQALNNERLLPNWKEQSYRELTSILQ
QSCYCLQHLDSWLW
Download sequence
Identical sequences Q1LWE9
7955.ENSDARP00000091564 ENSDARP00000091564 ENSDARP00000091564 NP_001038178.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]