SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000092527 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000092527
Domain Number 1 Region: 163-377
Classification Level Classification E-value
Superfamily RNI-like 3.53e-36
Family Cyclin A/CDK2-associated p19, Skp2 0.00000386
Further Details:      
 
Domain Number 2 Region: 78-133
Classification Level Classification E-value
Superfamily F-box domain 1.57e-18
Family F-box domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000092527   Gene: ENSDARG00000004937   Transcript: ENSDART00000101751
Sequence length 410
Comment pep:novel chromosome:Zv9:21:21298991:21309856:-1 gene:ENSDARG00000004937 transcript:ENSDART00000101751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNERVFQELSENLEGSLCRSQRTKWKKRPSCSSGLDTENTPNELIQQWSPPHKKALTTA
KGKENEENLFVLARRPRKRRESSANLCWDSLPDELLLGIFSRLSLQDLLRTSRVCKRWHR
LAFDESLWHSVDLVGKAQLDAELGQVLSAGVLRLRCPHTCIGQPSFKSTPSLRVQHLDFS
NCTVETSVLEDVLSRCKHLQNLSLEGLVLSDNIIYSLAQNPEIIRLNLCGCSGFSPESLT
EMLTACTRIEEMNVSWCDFSNLHIQAIASNIPSSVSQLNISGYRQNLTMEDVKAIVKRCP
NITDLDLSDSVLVTTDSFPVLQQLSSLRHLGLSRCYQIHPASLIDFEKFLNLQTLEVFGL
IQDSYLPILCKSLPHIQINTQPFSTVARPTSSSRKDRTLWGMHCRLVYKH
Download sequence
Identical sequences A3KP53
7955.ENSDARP00000092527 NP_001076306.1.45394 ENSDARP00000092527 ENSDARP00000092527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]