SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000093359 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000093359
Domain Number 1 Region: 232-366
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.55e-39
Family Synaptotagmin-like (S variant) 0.00077
Further Details:      
 
Domain Number 2 Region: 370-504
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.99e-21
Family Synaptotagmin-like (S variant) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000093359   Gene: ENSDARG00000070094   Transcript: ENSDART00000102583
Sequence length 539
Comment pep:known chromosome:Zv9:19:44176519:44191305:-1 gene:ENSDARG00000070094 transcript:ENSDART00000102583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKEPVLDLCHLTEVEQTVILNVLLRDAELRSREEGRVRKLQQTVSDPVHLRSLSGAWFH
EERSKRYEKGGADVVHASLRRKRRGKDLPLTAIFDKGNNSSHVHEQQEEDRNAERDLQGN
MNEREDDKHQEQKESGQEDGESLISNAITIPQSRTRNVTKRNEILGSGFEDSVEESENKE
RRILPSTSPTLQIDSEGDIDSGSTEINYTRFGSVTSLTSHHMMNGSLMSLYSVGDFGDVV
VSGRIQFSLQYDVRTEELYVHIIRCQDLASARKNRSDPYVKVYLLPDNTSRSKKKTAVRR
KTLNPVYDETMTYKVRRLDLPARVLSMSVWHMERMRRNLFLGELEVRLGQWDWSQNQPTW
QNLQPRVQLSPEAIISRGTILFSIKFVPPGSEGRGNPATGELHIWLREIVGLLPTKRGAP
NTYVKSVVLPDESGVSGQQTRVVRGSVSPVFNHTMVYDGFQSSDLIQACAEITVWNPHPS
GCLGGVRLSTGSGLSYGQSVCWMDSTEDEINVWSSVIQSPNSWVDTSLPIRTNLQLCSD
Download sequence
Identical sequences Q1L8P2
ENSDARP00000093359 ENSDARP00000093359 NP_001122005.1.45394 7955.ENSDARP00000093359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]