SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000094367 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000094367
Domain Number 1 Region: 360-434
Classification Level Classification E-value
Superfamily F-box domain 1.24e-17
Family F-box domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000094367   Gene: ENSDARG00000059115   Transcript: ENSDART00000103591
Sequence length 521
Comment pep:known chromosome:Zv9:4:392897:407500:1 gene:ENSDARG00000059115 transcript:ENSDART00000103591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLRVRISRQTCRLELQGEEPSLAELRARVRESLLTRFGLRSDLDFRLSLNGKEDLLDTG
QSLSSCGVVSGDLISVILPASSLEETQTSSAAAHQTHTDQQAGGSHVSSSSSVMEQHVQE
RVDQDLLERVDQQQEHVDLQQDCMDQQQQECVCAAAPPLLCCEAEDGLLPLALERLLDSS
TCRSPSDCLMLALHLLLLETGFIPQGGAVSSGEMPIGWQAAGGVFRLQYVHPLLENSLVS
VVAVPMGQTLVINAVLKMETSLENSRKLLLKPDEYVTAEWTGEAHTHTHTHTHTHTHTHA
SSLKAQRDYGLNDLPCVCAGGSSGVVYRDLRRLSRLVRDQLVYPLMATARQALGLPLLFG
LPVLPPELLLRLLRLLDVRSLVSLSAVCRHLNTATHDASLWRHLLHRDFRVSFPAGHQHR
DTDWRELYKQKYRQRKEAARRGRHWFYPPPISPLIPFPSPPAPLPLYPPGIIGGDYDQMP
VILPRPRFHPIGPLPGMSAPVGRRSLRPAGSGAADVRRAFI
Download sequence
Identical sequences ENSDARP00000094367 ENSDARP00000094367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]