SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000094999 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000094999
Domain Number 1 Region: 36-348
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.33e-17
Family WD40-repeat 0.018
Further Details:      
 
Domain Number 2 Region: 1081-1281
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00000837
Family Regulator of chromosome condensation RCC1 0.065
Further Details:      
 
Domain Number 3 Region: 815-954
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00000876
Family Regulator of chromosome condensation RCC1 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000094999   Gene: ENSDARG00000060835   Transcript: ENSDART00000104224
Sequence length 1358
Comment pep:known chromosome:Zv9:17:29339085:29370945:-1 gene:ENSDARG00000060835 transcript:ENSDART00000104224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNPAALPLREFCPLYYLLNAIPAKVQKGFRSVLVYLTALDSNSDYIAIGSSIGMLYLY
CRRVSQMNKYNLEGKCEAITAVKLLSCFDDLVAVGTASGRVAFFQLVSPLPGRNKQLRRF
DVVGLHKSTITALAWSANGMKLFSGDDKGKVVYSAVDLDQGVCNPVVLFEEPSAIVQLEY
SQKVLLVSSYQRSMLFYTQEQSHQQLGSKPRKSNGKFGACFQPALCKQSDLVVYAARPGL
RLWRTDVRGRVGETHVLKPLFNQDVPHFELFPRSGPTGGYRPSERQLGMISCFLKEGWVL
SWNEYSVYVVDCTNQVIIGGLESSGDIVSVSCTENEIFILKGDRDILRISNCPEGLVSNL
SDHSYRFTSPLSPPTILLPPNGAVETAQPIRTMPIITEQDTQASPSSEEVHDGVEESEEV
QEEQHLEEFSHAVEALEVAEDLEQQRASLGTVESRSRSSSITSWDSAQGMFTTTEASASE
LSSSRYSTITQEDFQQELVVKAIKLKKKGKRRRQESGNRMNERSSWSESIFSQDGAGSDV
LNTPMSEPPSDHTSLLCSSLDLDGEYHSSDAFPIQSPSEPLLNQEPCLVAVNQAAQTSPP
CPASLTLDMECQLYSENVFAENEQIAATPDVDMLLECTFSYMQASDEQDIMKKYVKEHKD
VLEDSEEHFKQSLHEDFNLDLSYDPIRPLGYSPEPEPSPSSDEEDIYAHGVPSSASLGDG
LNALSLQSSSAEQKEDEETQLLKADQLAESWMGYSGPGCGILSLVVTDRYIWCLDFKGGL
FCSGLSNGGLNWQKFEENVHQVALSPSGSLLWKVEQKTMTAYACGKVTIKGKRHWYKALD
DTAFVALGDDTAWIIRTNGDLYIQTGLSADRPCARSVKVDCPCPMAQMAARGGVVWALSE
QRGVFYREGLNSYCAEGEHWKYDTVSESQGLEPICIALGENNTVWALDTSGNLWFRTGVT
AKKPQGEDDHWWQVSITDYVVFDQGSLFQTLIQATQTVATVTRAPVERVAERLRVAFLSQ
HSQCQPSLISVNISGVWIASGRNEFHVAKGSLIGTYWRSTVPRGTASATKWAFVFSSAVP
AKEGSFLWLGQSRKDLFCIWDQDLQMRPFTIQFPPDVEMMQLSACRDALWGLDHYGRVHI
RTLSASCSTGMHWSLLDLSQLGHVRFLSLSCGSQNVWACDTNGMVYFRVGTQPLNPSMML
PAWICIESPEQPAGHYLVKIQTSPNDRMLWALDNRGNVLVRIGITEEMPVGTAWEHIPGL
QACQLVLSMRTAWVRLANGQVARRYGITEKNPAGDYWKKIPGLASCLAVTPMDELWAVSP
TGALNQRLTKTLQNYRSKNHVNAGSLSGEELEEEWEVI
Download sequence
Identical sequences F6P3V2
XP_005158848.1.45394 ENSDARP00000094999 ENSDARP00000121461 ENSDARP00000094999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]