SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000095305 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000095305
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily HMG-box 4.58e-30
Family HMG-box 0.00000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000095305   Gene: ENSDARG00000070929   Transcript: ENSDART00000104532
Sequence length 238
Comment pep:known chromosome:Zv9:6:26266208:26268117:-1 gene:ENSDARG00000070929 transcript:ENSDART00000104532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPADHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSESEKRPYIDE
AKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDHLKGLPVSATDSLLGSS
EKARAFLPPTSAPYSFLDPSQFSSSAIQKMTEMPHTLATSTLPYASSLGYQNGAFGSLGC
PSQHTHTHPSPTNPGYVVPCNCTAWSASSLQPPVAYILFPGMTKSGIDPYSSAHAAAM
Download sequence
Identical sequences Q32PP9
NP_001032769.1.45394 ENSDARP00000095305 ENSDARP00000095305 7955.ENSDARP00000095305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]