SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000095483 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000095483
Domain Number 1 Region: 29-114
Classification Level Classification E-value
Superfamily HMG-box 7.2e-27
Family HMG-box 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000095483   Gene: ENSDARG00000031198   Transcript: ENSDART00000104712
Sequence length 291
Comment pep:known chromosome:Zv9:25:7627183:7641854:1 gene:ENSDARG00000031198 transcript:ENSDART00000104712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEQSGSPGANTDNSSQRNGDEKPRRSSWTKGRRRKKPLKDSNAPKAPLTGYVRFMNERR
EQLRAERPDVPFPEITRMLGNEWSKLPADEKQRYLDEADKDKERYMRELEQYQKTEAYKH
FSRKVQEKQKGKRHRGDAGRQAPGESLHEKDLETKDRSVFDIPIFTEEFLNHSKAREAEM
RQLRKTNMEYEERNAALQKHVESMRSAVERLEGDVLQERTRNSLLLQHLETLRSALTHSF
STVPLPGSGETPTLESIDSYMKKLHSLILSSPQDHQHLISTVRDVVNRLDR
Download sequence
Identical sequences A3KNQ1
7955.ENSDARP00000095483 ENSDARP00000095483 NP_001082803.1.45394 XP_017209545.1.45394 ENSDARP00000095483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]