SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000095563 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000095563
Domain Number 1 Region: 91-269
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-72
Family F-box associated region, FBA 0.0000118
Further Details:      
 
Domain Number 2 Region: 30-113
Classification Level Classification E-value
Superfamily F-box domain 9.16e-18
Family F-box domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000095563   Gene: ENSDARG00000071045   Transcript: ENSDART00000104793
Sequence length 278
Comment pep:known chromosome:Zv9:23:16932066:16939951:1 gene:ENSDARG00000071045 transcript:ENSDART00000104793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQAESRNTDAPLTDLRSFESRSAAFSGVMAVVPLTVVEEILLNLPARVVNECRLVCQEW
KELVDSSAHWRERCRREGIQPCNASRPPEDWRQFYFMTKKRRNLIKNPKAEDSLTGWEFV
DNGDDGWYQENRKPFSDDSQPNFATSYELCLKKQLIDLQKEGYSTAFMDEVQPHIKISDW
YGPYFDGGCEYQICVELLDQKKEPIDTFQPEKVVIEQWNDEPWCKMTHVFKDYGPGVRFI
RFTHGGKHTQFYSGYYGIRVTNSSVEICPAAERESFPA
Download sequence
Identical sequences E7F9Z7
ENSDARP00000095563 ENSDARP00000095563 7955.ENSDARP00000095563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]