SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000096022 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000096022
Domain Number 1 Region: 515-631
Classification Level Classification E-value
Superfamily F-box domain 0.00000013
Family F-box domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000096022   Gene: ENSDARG00000071259   Transcript: ENSDART00000105251
Sequence length 652
Comment pep:known chromosome:Zv9:17:10645543:10647621:-1 gene:ENSDARG00000071259 transcript:ENSDART00000105251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLKPYPKPQDKEIHRESVRDATRGLHADQQGVLRKEWGVHQSCGLMGSPGNGTANRCPL
GVISPNTLRCNTNSGSNVPTRLSPSTGLENEGSLGIYQGEDEEGSLDIWAVIKPGNTKEK
IAIFASQMCSSTCASVKNKGCWDVDCSLPKRRRRSENPDKLKILEPLSPKLEMHNVLQQE
AHCENINPCQGLAEDAVKTEGEEDEKTVSVVEMVAYLEQMANDQQIGSKSPSLRSTSTII
LSKVGSITQPDEQQSKAKEQLEVQEEEGESIRVLDMVAKLESQCLNRQNLRENGGELSRN
NSLRRKVGRVLLAGSEPYPLQSQPVSPTDPQDSGVESVPQELGSDFDKRSSQIKTLELIE
ITKCELDICAPEEKETSCIARLETCTAVETVNNLQSSPKDASSESSEEPLPGMLFFAKSS
PQPPKAQHLPSLKSRSLNKEPSRIHKLPVDIKASFTEEIRDELASEIQNHRIFEETESRE
TCLVSQEPVPFPLRRLVSHEFLETRFKIQLLLEPQQYMAFLPHHIIVKIFCLLPTESLAA
LKCTCHYFKCIIESYGVRPADSRWVIDPRYKDDPCKQCKKRYDRGDVSLCRWHHKPYCQS
LPYGPGYWMCCRRSHKDSLGCNVGLHDNRWVPAFHSINVPIYKRSRDTDEDS
Download sequence
Identical sequences ENSDARP00000096022 ENSDARP00000096022 7955.ENSDARP00000096022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]