SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000096387 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000096387
Domain Number 1 Region: 30-390
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.13e-65
Family WD40-repeat 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000096387   Gene: ENSDARG00000044440   Transcript: ENSDART00000105610
Sequence length 524
Comment pep:known chromosome:Zv9:24:42618266:42643429:-1 gene:ENSDARG00000044440 transcript:ENSDART00000105610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATHHRQNAAGRRKVQVSYVIRDEVEKYNRNGVNALQLDPALNRLFTAGRDSIIRIWSVN
QHKDPYIASMEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVK
ALAYAKDKELVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQMGT
VIVSGSTEKVLRVWDPRTCAKLMKLKGHTDNVKSLLLNRDGTQCLSGSSDGTIRLWSLGQ
QRCIATYRVHDEGVWALQVNEAFTHVYSGGRDRKIYCTDLRNPDIRVLICEEKAPVLKME
LDRSADPHNAIWVSTTKSTVNKWSLKGIHNFRASGDYDNDCSAPLTPLCTQPEQVIKGGA
SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKMEFDEEIKKRFKMVYVPNWFS
VDLKTGMLTITLDESDCFAAWVSAKDAGFSSPDGSDPKLNLGGLLLQALLEFWPRTHINP
MDEEKRWTNAETLSVSVSPLLFSLISHSSDVFVANDVFRSAELL
Download sequence
Identical sequences F1R8P7
ENSDARP00000096387 ENSDARP00000096387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]