SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000097617 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000097617
Domain Number 1 Region: 330-419,766-927
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.95e-37
Family Protein kinases, catalytic subunit 0.00035
Further Details:      
 
Domain Number 2 Region: 7-126
Classification Level Classification E-value
Superfamily PX domain 3.14e-23
Family PX domain 0.0022
Further Details:      
 
Domain Number 3 Region: 228-309
Classification Level Classification E-value
Superfamily MIT domain 6.93e-20
Family MIT domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000097617   Gene: ENSDARG00000076212   Transcript: ENSDART00000115220
Sequence length 929
Comment pep:known chromosome:Zv9:20:3268066:3315107:-1 gene:ENSDARG00000076212 transcript:ENSDART00000115220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISARNKDEIVRFYTVTDPTTHKKGYTVYKVTARIISRNNPEDIQEITVWKRYSDFKKLH
QDLWQIYRNLCGQSELFPPFAKAKVFGRFDDSVIEKRRQCSEDLLQFSANIPALYGSSYI
QDFFKGGEVQDSSELIGPAEPFSDFLADSLLDSSSEGGSSFSELNSFEVDGDSLVAVDDG
MASGSLKQSSHSSGTLSFASVSQQCSLKQSSHSSRTLSFASGLKNCTGKLDYLEKASEQI
SLAVQKEVEQDFAEAFSYYRRGVDLLLQGVQGEVSPSRREAVKRKTAEYLMRAELISAQL
IDGMGQSSTQSRALGSQCCGGSWTDQTHSDELKHYRVLGVIDKVLLVMDNRTQETFILKG
LRKSSSCGRIKKTIVPRTVPNMVQLEKYIISEDSIFLLLQYAEGGQLWTHISKYLHGSSP
DESVNMPMIQKVNSAAMHSTLTPVPTGSSSADSQALSLGEHPLAAQQPDSGGTSEEECTN
SYLTLCNEYEQEKLEPEEDHSSFNPADAQKHTSLVLNTDSLCSPISIQELSFFTEEEQIA
SFMDQSTASPDSLNQSSPLERFQSDRNDACTALLPSDADVEVLEEPLQKPQVVSDLWRAD
GDQCSNELVPVISFKEAVQEDATVSCAVEGQPPDLLVNLPVLEADTVETVVEELIAFNAV
AKTSPTFGGPDVLQGGEKAELELPIDLTTLPLYRPPAAPFGKDLIPSSPMLDGAISKTQT
GCVEHEDLGLGLEGTSGEQEVEEVSKLFQELDKLAAVSLDTHIPEALVRSWAADIVVALD
ALHQEGIICRDLNPSNILLNHTGRVQLTYFCSWSDVEESCDPNAISKMYCAPEVGGICEE
TVASDWWSLGALLFELIVGKSLYQCHPAGIGRHSSLNIPEFVSEEARSLMEQQLLQYNPV
ERLGAGVAGVEDIKSHPFFSHVNWNHLLE
Download sequence
Identical sequences ENSDARP00000097617 ENSDARP00000097617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]