SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000097628 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000097628
Domain Number 1 Region: 191-302
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.61e-32
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 
Domain Number 2 Region: 351-468
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.09e-30
Family PLC-like (P variant) 0.0000387
Further Details:      
 
Domain Number 3 Region: 30-159
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.85e-28
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000097628   Gene: ENSDARG00000076404   Transcript: ENSDART00000113985
Sequence length 726
Comment pep:known chromosome:Zv9:5:52128340:52387803:-1 gene:ENSDARG00000076404 transcript:ENSDART00000113985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALSLSSVGQSLSGINIVEPSNDELPPLPKPRMYQLDIVLKKGNNLAIRDRGGTSDPYV
KFKIAGKEVFRSKTIHKNLNPVWEEKVSLLVESLREPLYVKVFDYDFGLQDDFMGSAYLY
LESLEHQRTLDVTLDLKDPHYPKQDLGSLELAVTLIPKEGDFREATMLMRRSWKRSSKHQ
SLRLSDVHRKSQLWRGIVSISLIEAHDLQPMDNNGLSDPYVKFRMGHQKYKSKTIPKTLN
PQWREQFDFHLYDEQGGFVDITVWDKDAGKKDDFMGRCQVDLSLLSKECTHRLDLPLEEG
EGMLVLLVTLTASAAVSIADLSVNVLDDPHERKEILHRYNVLRSFHNIKDVGMVQVKVIR
AEGLMAADVTGKSDPFCVVELSNDRLQTHTVYKNLNPEWNKVFTFNVKDIHSVLEVTVYD
EDRDRSADFLGKVAIPLLNIQNGERKAYALKSKELTGPTKGVIFLEIDVIYNVVKAGMRT
LIPIEQKYIEEEPRVSKQLLLQNFNRVRRCIMFLINAGCYINSCFEWESPQRSICAFLLF
VLVVWNFELYMVPLVLLMLLAWNYILIASGKDTRQGDVQAVEDLLEDEDEDFDRDDKDSE
RKGFMNKLYAIQDVCISVQNALDEVASYGERIKNTFNWTVPFLSWLAIVALCVVTLVLYF
IPLRYIVLAWGVNKFTKKLRDPYSIDNNELLDFLSRVPSDVQVMQYRELKVDPCHSPNKR
KKNNPG
Download sequence
Identical sequences ENSDARP00000097628 ENSDARP00000097628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]