SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000097865 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000097865
Domain Number 1 Region: 418-473
Classification Level Classification E-value
Superfamily CCCH zinc finger 1.7e-19
Family CCCH zinc finger 0.0000504
Further Details:      
 
Domain Number 2 Region: 390-416
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000072
Family CCCH zinc finger 0.00044
Further Details:      
 
Domain Number 3 Region: 362-387
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000746
Family CCCH zinc finger 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000097865   Gene: ENSDARG00000078355   Transcript: ENSDART00000109318
Sequence length 1340
Comment pep:known chromosome:Zv9:15:23063096:23074898:-1 gene:ENSDARG00000078355 transcript:ENSDART00000109318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVESMTVHPNSPTANHEHNSLLTDERQEDGELEEGELEDDGGEAEVPSGEVADPQDKPR
HSKERHASESNDEEKSHRRRRKRKREREREKEKRRAKKKRKSKHKRHQSSSDEYSDYSDE
SDYSPSEKRKYREYSPPYPPTSQGGYSSAPSGHGGPMSKKGGYMKIDKQGYGGYDDYEEE
TYEGEDDEDMGDDDYDDFAKELNQYRKAKEVGGPRGRGGKNRMKNLRGRGRGGMRGRGGR
GGGRGRGRGKMGGENDDGDGMYGEDMEYGDDDYDNMGDDDYDDYSKELNQYRKTKDRGRG
GKGGRGRGRGKGGRGMNRGRGRNRGRGRGGDQGPDDDNSGDKDMDGSGPPRRNDQEKHGP
EKKGKAICKYYIEGRCTWGDHCNFSHDIELPKKKELCKFYITGFCARAENCPYMHGDFPC
KLFHTTGNCVNGEECMFSHDSLTEDTQELLDKMLAEDAEAGAEDEKEVEELKKQGINPLP
KPPPGVGLLPTPPRPSPGDSSTPMEFGMPSAPHGNIPPSGPPAPGPGVGPVPGPGPGPGP
GPGIGPCPVPPPPCTDGGTFQGPPPTGPPPPMGPPPVCGGNAGKKIPSLFEIVVKPTGQL
AQKLGVRGPVPANASAGTAGPQGPPPGPPGAPPPRFPPPPGHMGPGGPHERPPMGPSNMN
QGPPSMGTGPPMMQNFVQGEGPPNPGMMSPGAGSAGNNFYDNFYQQQQAMSIDGSGRDCD
NFQGMGGGNFNDQSPGNHNSGSMESGANVGPSNQTGMAVPDFLPPAQRVLFMRLQQKQQE
DEERARRLADGGGTERENEGGDSANWYSSEDEDGGGSVTSILKTLRQQTQNQGPAKPDGA
PSDPRLQKSQPTPAPSRPADPRLARDPRLSRNTDSSQAPEASSSLSPTPSDPRLARHAAA
HASKPEPPLVYKPPPLTAPASNEEEEGERMLRDKPVPIPLDPLMGMALRDPRSQLQQFSH
IKKDVVLQKPSFSKAVLWSPEDLIPIPIPKQDLLPLPPGIPPVTTIDPRLSRTQPPHHSS
ILPPTVVPPPAPVEQSNQSSSSLPDFELLSRILKTVNASSSSPVQGASTGISSPPSVSSE
KPIDPRMARKTPADPRLQPQKSALKTTSEPLVPQGSPPTSSLSPPSSSPTIAPYDPRLLS
AGGSVRSVGSASVGSSSGGTSVLSGISLYDPRSQGADKTEGSVATRNSSPPPEPKSSEST
TASAKPKSKEPLFVRKSALDQPEPEKSSTEQTTDRYNSYNRPRPKPSPSPNAGTAAAPTA
TSGPSTAGQGTTVSAEQPAAVHNLPVSTLFTMVKQVNKPSGTGSPFGGSSPAQPDTAEQD
NASLKDVFKGFDPTASPFCQ
Download sequence
Identical sequences E7FGZ9
ENSDARP00000097865 XP_005157662.1.45394 ENSDARP00000097865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]