SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000097903 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000097903
Domain Number 1 Region: 33-352
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.05e-32
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000097903
Domain Number - Region: 752-833
Classification Level Classification E-value
Superfamily MIT domain 0.00051
Family MIT domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000097903   Gene: ENSDARG00000077749   Transcript: ENSDART00000111558
Sequence length 1256
Comment pep:known chromosome:Zv9:12:27768999:27889467:-1 gene:ENSDARG00000077749 transcript:ENSDART00000111558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWKRNYFASGSGGGSLQGMFTPRNMTSIAPSKGLSNEPGQNSCFLNSALQVLWHLDIFR
RSFRQLNTHKCMEDSCIFCALKSIFAQFQFSSEKVLPSDALRSALAKTFQDEQRFQLGIM
DDAAECFENLLMRIHFHISDESKEDICTAKHCIPHQKFAMTLFEQCVCNNCGATSDPLPF
IQMVHYISTTSLCNQAVRMLECKEKPTPDMFGELLRNASTMGDLRNCPSNCGEMLRIRRV
LMNCPEIISIGLVWDSDHSDLAEDVIHSLGTCLRLGDLFYRVTDERAKQSELYLVGMVCY
YGKHYSTFFFQTKIRKWMYFDDAHVKEIGPKWKDVVSRCIKGHYQPLLLLYADPRGTPVS
SQDMLAAQLDLHHSSKAGYDSEDSGREPSISSDTRTDSSTDSYSYKHSRSHHESMASHFS
SDSQGTVVCNQDSSGSQNSMDTAGEVLDQATPICTPRPSSTGHLQDYKETVNMIHSRPLS
SSSSSGVGGSEAGARARDWEDESTSSESKSSSSGGRYRPTWRPRREALNIDSIFSRERHR
PVGYTTLGPSPLPEDPMSPVHGELVSVAVAEGSNGAAGETGDMTDGSGGAVEPGVEHVPN
PPPLRGVEQQPRLIQRMESGYESSERNSNSPISMDMPLSDNPNSSAHRDFGNKRPVTSGP
SWRTVPKSKSSSAILQDLKSPTWSSAALSLGEERSELDELQEEVARRARQQELQRKKEKE
REAAQGFNPRPSKFMDLDELQHQGKGGSFEHCLAEADSLIEQSMRLEQAGDTATALALSH
HAVSKLRFSMHEGSANTHSRTMAADAKLQKCMRRARGLQQRMQQQQEQPQEPSRPQGPIS
EQPGPVQVLLTDNQEEVWETNPDSVLGPPSPQHMNSPSSCTNSPSQLSNRPSLNPGSSQP
HPQESEVCSNWSKQKEEEWGGIRLSDVLQASGIRVMPIRKHLAISLPSLPLDFWGVLGED
EEHPQASIPQNPNPPLWQDIADSPEKVRQSNTSTSPTPATNEEKGSMPRRVPIWQPLCTS
SHPCNKLSPPVAARHWSSWSLDRPDAVITPYDTPPEQNLRAGSVLSQHTSGRHLPPRSPM
STRKKNISKHSSFQSIDLEPTEAEDQELSELDSLYQASLQAGPAPGRALRGTSSPAVGRS
VPPAARKLLTGVGRSRTPTAELERTAYGPPGCYSPTGYMNMPLSVAHQGLQSEEDDQYDA
DHLRRIARSLSGTVIGRRQNRLAVSRSFDVSRGSPSFWLCLTGVKLSPVGSTTVHH
Download sequence
Identical sequences A0A286YAP7
ENSDARP00000097903 ENSDARP00000097903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]