SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000097904 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000097904
Domain Number 1 Region: 516-779,857-940
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.81e-28
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.027
Further Details:      
 
Domain Number 2 Region: 983-1166
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.18e-20
Family DnaQ-like 3'-5' exonuclease 0.0039
Further Details:      
 
Domain Number 3 Region: 165-360
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000753
Family WD40-repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000097904   Gene: ENSDARG00000074675   Transcript: ENSDART00000111836
Sequence length 1215
Comment pep:known chromosome:Zv9:23:32220378:32245949:1 gene:ENSDARG00000074675 transcript:ENSDART00000111836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFEGLDPGLGDYAPGLHGGLEPGLDSSLDPRLDPALLQGVEIDPDGLAVSESVHIVEGM
YSELHSVAAEVGIPVTATHFDLQEELLWMGNHRGHASSFFGPTMGRYSSFQVHMTDDIRH
IQSMDTGVLFLTKNNLRCLTRGGFIMFDYPMEEGADMHSLILTENNTLLMGGLQNYVAEL
DLTTVQETQKFTVEVPGVAIMRQTSRFFFCGHTSGKVSLRDLRTFKMEHEFDAFSGSLSD
FDIHGNLLAACGFSSRGLNGLSCDRFLMVYDLRMMRAVTPLQVHVDPLFLRFIPTYTSRL
AIISQTGQCQFCEPTGLASLADIFHVNTVGQLLMSFDVSSSKQALSFGDSGGCVHLWSSA
PEVSYNSYSRDTELALPCLVDSLPQMDWNHELMPLSLLPMPLTSTEPLLSDWPTALIAPS
PRRAPPVDPEILRTMKTVGFIGYAPNPRTRPRNQQVPYKIKDVELDYDSYNQVPESPIGR
DEEPHLYMVPKKYRKVTIKYSKLGLEDFDFKHYNRTLFAGLEPHIPNAYCNCMIQVKYFL
EPIRCLVQNHLCQKEFCLACELGFLFHMLDLSRGDPCQASNFLRAFRTIPEASALGLILA
DSDEQTGKARLGRLIQSWNRFILAQLHQETLEQEGPQAYRGASSSVLSSSGESVISRLFG
CEVENSSLCCCGKETVRSSLTLLFTMHYPETEKKIEEYEFVDILRKSICLEQSTQAWCDN
CEKYQPTVQTRNIRCLPDVLVINCEVNSAKEAEFWKAQTEYVFNKALKKEAAEPPKPKEP
LPTEWCLDFREELCNVEGLTFDTQAEDMRHVWIPLSLRMCISKAQGLEVSSLTEGEEVRL
TSRYFKHGLTESEEAEGVSIYDLFVTVSHVQDTRTGGNMVAHIKVGETYHQRKEGVTHQQ
WYLFNDFLIEPIDKAESVQFDVNWKVPAVLYYIKRNYHTKFDLRIKNPIEASVLLTEASL
ARKQRKSHATFIPLMVSEMPQVGDLVGLDAEFVTLNQEEAELRSDGTKSTIKPSQMSVAR
ITCVRGQGQNEGVPFIDDYISTQEQVVDYLTQYSGIKPGDLDAKISSKHLTTLKSTYLKL
RFLIDTGVRFVGHGLQKDFRVINLMVPKDQVIDTVYLFHMPRKRMISLRFLAWYFLDLNI
QGETHDSIEDARTALQLYRKYLELSHNGGQEEFRKVLKALYEKGRKLDWKVPDIDSADGQ
GSPKSTAVFPSVMGL
Download sequence
Identical sequences ENSDARP00000097904 ENSDARP00000097904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]