SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098742 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000098742
Domain Number - Region: 1144-1289
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00692
Family WD40-repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098742   Gene: ENSDARG00000034178   Transcript: ENSDART00000110017
Sequence length 1451
Comment pep:known chromosome:Zv9:19:12520943:12573308:-1 gene:ENSDARG00000034178 transcript:ENSDART00000110017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYAVYRQAHPPTAVEFAVYCNFISSQEKNLVVAGTSQLYVYRIIYDVESTSKSEKSSDGK
SRKEKLEQVASFSLFGNVMSMASVQLVGTNRDALLLSFKDAKLSVVEYDPGTHDLKTLSL
HYFEEPELRDGFVQNVHIPMVRVDPENRCAVMLVYGTCLVVLPFRKDTLADEQEGIVGEG
QKSSFLPSYIIDVRELDEKLLNIIDMKFLHGYYEPTLLILFEPNQTWPGRVAVRQDTCSI
VAISLNIMQKVHPVIWSLSNLPFDCNQVMAVPKPIGGVVVFAVNSLLYLNQSVPPFGVSL
NSLTNGTTAFPLRPQEEVKITLDCSQASFITSDKMVISLKGGEIYVLTLITDGMRSVRAF
HFDKAAASVLTTCMMTMEPGYLFLGSRLGNSLLLRYTEKLQETPMEEGKENEEKEKQEEP
PNKKKRVDSNWAGCPGKGNLPDELDEIEVYGSEAQSGTQLATYSFEVCDSILNIGPCASA
SMGEPAFLSEEFQTNPEPDLEVVVCSGYGKNGALSVLQKSIRPQVVTTFELPGCHDMWTV
IYCEEKPEKPSAEGDGESPEEEKREPTIEDDKKKHGFLILSREDSTMILQTGQEIMELDT
SGFATQGPTVYAGNIGDNKYIIQVSPMGIRLLEGVNQLHFIPVDLGSPIVHCSVADPYVV
IMTAEGVVTMFVLKNDSYMGKSHRLALQKPQIHTQSRVITLCAYRDVSGMFTTENKVSFL
AKEEIAIRTNSETETIIQDISNTVDDEEEMLYGESNPLTSPNKEESSRGSAAASSAHTGK
ESGSGRQEPSHWCLLVRENGVMEIYQLPDWRLVFLVKNFPVGQRVLVDSSASQSATQGEL
KKEEVTRQGDIPLVKEVALVSLGYNHSRPYLLAHVEQELLIYEAFPYDQQQAQSNLKVRF
KKMPHNINYREKKVKVRKDKKPEGQGEDTLGVKGRVARFRYFQDISGYSGVFICGPSPHW
MLVTSRGAMRLHPMTIDGAIESFSPFHNINCPKGFLYFNKQGELRISVLPTYLSYDAPWP
VRKIPLRCTVHYVSYHVESKVYAVCTSVKEPCTRIPRMTGEEKEFETIERDERYIHPQQD
KFSIQLISPVSWEAIPNTRVDLEEWEHVTCMKTVALKSQETVSGLKGYVALGTCLMQGEE
VTCRGRILILDVIEVVPEPGQPLTKNKFKVLYEKEQKGPVTALCHCSGFLVSAIGQKIFL
WSLKDNDLTGMAFIDTQLYIHQMYSIKNFILAADVMKSISLLRYQPESKTLSLVSRDAKP
LEVYSIEFMVDNNQLGFLVSDRDKNLMVYMYLPEAKESFGGMRLLRRADFNVGSHVNAFW
RMPCRGTLDTANKKALTWDNKHITWFATLDGGVGLLLPMQEKTYRRLLMLQNALTTMLPH
HAGLNPKAFRMLHCDRRTLQNAVKNILDGELLNKYLYLSTMERSELAKKIGTTPDIILDD
LLEIERVTAHF
Download sequence
Identical sequences ENSDARP00000098742 ENSDARP00000098742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]