SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098826 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098826
Domain Number 1 Region: 100-184,213-320,371-392
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.87e-34
Family WD40-repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098826   Gene: ENSDARG00000079220   Transcript: ENSDART00000112803
Sequence length 596
Comment pep:known chromosome:Zv9:17:158267:170441:-1 gene:ENSDARG00000079220 transcript:ENSDART00000112803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKMAAEGGGKEMNEIKSQFSTREGAYKLLSHSEYSRPNRVPFNSQGSNPVRVSFVNVND
QSGNGERICFNVGRELYFYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHLTATAESVC
LLVGFSAGQVQLIDPIKKETSKLFNEERLIDKSRVTCVRWVPGSESLFLVAHSSGSMYLY
NVEHTCGTTAPHYQLLKQGESYAVHTCKSKSTRNPLLKWTVGDGALNEFAFSPDGKFLAV
VSQDGFLRVFNFDAVELHGTMKSYFGGLLCVCWSPDGKYIVAGGEDDLVTVWSFADCRVI
ARGHGHKSWVSVVAFDHYTTSVEESEPMEFSGSDEDFQEQLQCGRERANSTQSRLSKRNS
TDSRPLSVTYRFGSVGQDTQLCLWDLTEDILFPHLPLSRTRTHTNVMNASAAPAASSSTL
IANTANSANGSGSSTNTPGNALPAPLPRSNSLPHSAAGAANSRSSENPAAAGVSKFATLS
LHERKERHPDKDHKRNHSMGHISSKSSDKLNLLTKTKTDPAKTLGTPLCPRMEDVPLLEP
LVCKKIAHERLTVLIFLEDCIVTACQEGFICTWARPGKVGLLSSQTQANSPSGTVV
Download sequence
Identical sequences E7FA76
ENSDARP00000098826 ENSDARP00000098826 XP_021322926.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]