SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099166 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099166
Domain Number 1 Region: 147-228,269-484
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.27e-55
Family WD40-repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099166   Gene: ENSDARG00000074611   Transcript: ENSDART00000111491
Sequence length 494
Comment pep:known chromosome:Zv9:24:3563082:3604422:1 gene:ENSDARG00000074611 transcript:ENSDART00000111491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVESGNSAAARQVKQKRKSHSLSIRRTNSTEQDRTGMQRDMLEGQDSKLPMALRSNLLD
LFGQIEREFENLYIENLELRREIESLNERLSGEGQTVEGGDLSKGALKTKASHSTSQLSQ
KLKTTYKASTSKIVSSFKATTSRAVCQLVKEYVGHRDGIWDLAVTRVQPLVLGTASADHC
SMLWSIETGKCLLKYAGHAGSVNSIKFHPTEQMALTASGDQTAHIWRYMVQLPLPQPPAD
ISASLDDDVDFSDKDEADGDADGPNECPTIRVATTTLKSHQGVVIAADWLVGGKQVVTAS
WDRAANLYDVETSELVHTLTGHDQELTHCCTHPTQRLVVTSSRDTTFRLWDFRDPSIHSV
NVFQGHTDTVTSAVFTVGDNVVSGSDDRTVKVWDLKNMRSPIATIRTDSAVNRISVSANQ
RIIALPHDNRQVRLFDMNGVRLARLPRSNRQGHRRMVCCSAWNEENQACNLFTCGFDRQA
IGWNINIPALLQEK
Download sequence
Identical sequences E7FEE4
NP_001161736.1.45394 ENSDARP00000099166 ENSDARP00000114888 ENSDARP00000099166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]