SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099567 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099567
Domain Number 1 Region: 41-244,277-311,527-604
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.51e-57
Family WD40-repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 360-466
Classification Level Classification E-value
Superfamily TPR-like 1.07e-20
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099567   Gene: ENSDARG00000059760   Transcript: ENSDART00000113358
Sequence length 674
Comment pep:known chromosome:Zv9:16:58473175:58495396:-1 gene:ENSDARG00000059760 transcript:ENSDART00000113358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCCETMTLRNITGDLLHRQIRENRALDFQRHYHVTDPFIKRLGLEAELQGHSGCVNCLE
WNEKGDLLASGSDDQHAIIWDPFRHSKLITMHTGHAANIFSVKFLPHSDDRILITGAADT
KVHVHDVTAKETIHMFSDHTNRVKRIATAPMWPNTFWSAAEDGLIRQYDLRESSKRSDVL
IDLTEYCGQLVEAKCLAVNPRDNNYLAVGANGPFVRLYDIRMIHNHRKSLSQSSSAGVHT
FCDKRKSIPDGAGQYYVAGHLPVKLPDYNNRLRVLVATYVTFSPDGTELLVNMGGEQVYL
FDLTFKQRPYTFLLPKKCHSSTDVQNGKTTNGVSNGIHLPASRLKLAKVSSSGSGDLPLH
LERIKQRANDAFARQQWTQAIQLYSLGIHEAGPNAMLYGNRAAAYMKRKWDGDHYDALRD
CLKALSLNPGHLKAHFRLARCLFELKYVAEALECLNDFKGKFPEQAHSSACDALDKDIKA
ALFSKTDASDDKKGNSSIRFHNFSRKESIPEDEIVLRERSFDYKHRYCGHCNTTTDIKEA
NFFGSKGQYIVSGSDDGSFFIWEKETTNLVRILQGDESIVNCLQPHPGHCFLATSGIDPV
VRLWSPRPECENENGRVVEDMEGAAQANQRRMNADPLEVMLLNMGYRISGLSSRGAEGSD
EEDSSEGQVQCRSS
Download sequence
Identical sequences B3DJF2
ENSDARP00000099567 7955.ENSDARP00000077843 ENSDARP00000099567 NP_001124078.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]