SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099929 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099929
Domain Number 1 Region: 31-128
Classification Level Classification E-value
Superfamily F-box domain 1.28e-16
Family F-box domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099929   Gene: ENSDARG00000074170   Transcript: ENSDART00000108731
Sequence length 369
Comment pep:known chromosome:Zv9:8:32494046:32549055:-1 gene:ENSDARG00000074170 transcript:ENSDART00000108731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRSIVVQSLRSIRDRFFDTRRHRNEQSDGPSDDAMGASLDNLSVDMQFLIMTFLSPQD
LCRLGGTSTYWRSMVRDPVLWKYFLLRDLPLWQSVDHLSLPRVKLNSSAVLEDSEMHFDY
MAEYLRVCPACRNQWRHQPRAAFESVASFFQSFVPVAEPQFAIFGPGLEQLEVSLMNVMM
NSPEILPIAGIPQRQIDGIGSGISFKYKDQHRFNIATLYSNNRMERERARLEQLSLRSKI
FIYEEDSESNIPASLNPMFNQVCQAVNGFIFVANAETERGMDKSWEEEIAQIRVMLDPAV
GTASRPVLILSCVSRETPDRQRIHCVTIAHQLQLSSLVNPWMVLDTTAETLTGLLDGIDW
LLRHSGIKL
Download sequence
Identical sequences XP_002663185.3.45394 XP_021334144.1.45394 ENSDARP00000099929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]