SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000100169 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000100169
Domain Number 1 Region: 24-108
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.74e-18
Family Synaptotagmin-like (S variant) 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000100169   Gene: ENSDARG00000074547   Transcript: ENSDART00000113628
Sequence length 134
Comment pep:novel chromosome:Zv9:4:7210120:7210735:-1 gene:ENSDARG00000074547 transcript:ENSDART00000113628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFCDLRLVSLAVLMLASQLDFASASVRVFGLHARDLTGDPFGNEPDPYVKVWCGAVSG
GQTEYHKDNANPTWSAEFNFPNCKCGDDVKLEIWDKDKTFDDHLGTCNKLVQYGSFAVTC
YLNKGTFFYRYEAK
Download sequence
Identical sequences Q5RI57
ENSDARP00000100169 7955.ENSDARP00000100169 NP_001076399.1.45394 ENSDARP00000100169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]