SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000100360 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000100360
Domain Number 1 Region: 653-1015
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.67e-42
Family Quinoprotein alcohol dehydrogenase-like 0.026
Further Details:      
 
Domain Number 2 Region: 132-199,255-398,456-525
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.25e-38
Family WD40-repeat 0.0064
Further Details:      
 
Domain Number 3 Region: 1505-1579,1631-1776,1834-1902
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.3e-35
Family WD40-repeat 0.0061
Further Details:      
 
Domain Number 4 Region: 10-285
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.01e-32
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 1124-1226,1345-1528
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.58e-31
Family WD40-repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000100360   Gene: ENSDARG00000053517   Transcript: ENSDART00000112088
Sequence length 1908
Comment pep:known chromosome:Zv9:17:43085339:43264853:-1 gene:ENSDARG00000053517 transcript:ENSDART00000112088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLALHPERVLVATGQVGKEPYICVWDSYTVQTVSILRDMHTHGIACLAFDLDGQCLVSVG
LDSKNTICVWDWRQGKVLAAAQGCIGKIFDISWDLYQQSKLVSCGVKHIKFWSLCGNALT
PKRGVFGKTGDLQTILCLACARDEITYSGALNGDIYVWKGINLIRTVQGAHGVKIFACHK
GFATGGRDGCIRLWDLNFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGTQDSEIFEV
VVHDRTKPFLIMQGHCEGELWALAVHPTKPLAMTGSDDRSVRIWSLVDHALIARCNMEEP
IRCAAVSTDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGAHLAVGSN
DNSVDIYGVVQRYKKVGECVGSSSFITHMDWSTDSKYLQTNDGNGRRLFYRMPSGKEVTN
REELKLVQWSSWTCVLGPEVNGIWPKYSDINDINSVDANFSSQVLVTADDYGLVKLFRYP
CIRKGAKFKKYLGHSAHITNIRWSHDYQWVITIGGADHSVFQWKFVPERKSKDTLHIAPQ
ETLIDSHSEESDSDQSDVPEMDSEIEQETQLTYRRQVYKEDLPQLKEQCKEKHRAMAMKK
RERAPASGMRLHFIHGYRGYDCRSNLFYTQTGEIVYHVAAVGVVYNRQQNTQRFYLGHDD
DILCLAIHPVKDYVATGQVGRDSSIHIWETEFLKPLSVLKGFHQFGVCALDFSAADGKRL
ASVGLDDNHTIVLWEWRKGEKLSTIRGSKDKIFVIKINPYMPDKLISAGVKHMKFWHRAG
GGLIGKKGSMGKTETMMCAVYGWTEEMVFSGTCTGDICIWRDMFLVKTVKAHDGPVFSMH
ALEKGFVTGGKDGIVALWDDTFERCLKTYAIKRAVLAPGSKGLLLEDNPSIRAISLGHGH
ILVGTKNGEILEVDKNGPITLLVQGHMEGEVWGLATHPHLPLCATVSDDKTLRIWDLSPS
HCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLIVNADTLEDLVSFHHRKDIISEIRF
SPVTGKYLAVASGDSFVDIYNVMSSKRVGVCKGSMNYITHLDWDKRVGKLLQVNTSAKEQ
LFFEAPRGKKQSIPVTEVEKIDWSTWTCVLGSSCEGIWPVVSEVTEVTAACLSYDKKLLA
TGDDLGYVKLFKYPVKGKYAKFKRYMAHSTHVTNVRWSHDDSLLASVGGSDTCLMIWNHE
TESCREARQCDSEESDIESEDDGGYDSDVTRENEIVYVIKALSTNMRPMTGVKPHLQQKE
PTVDESDGFLEMCRPPVSRAPPMPEKLQTNNVGKKKRPIEDLVLELVFGYRGNDCRNNVH
YLNEGADIIYHTASIGVVLNLTTACQSFYLEHSDDILCLTINQHPKFPNVVATGQVGDTG
DMSATSPSIHVWEAMNKQTLSVLRCHHSRGVCSVSFSATGKLLLSVGLDPQHTLTIWKWQ
EGAKVASRAGHTQRIFVAEFRPDSDTQFVSVGIKHVRFWTLAGRALLSKKGVLSSIEDAR
MQTMLSVAFGANNLTFTGTISGDVCVWKEHILVRIVAKAHTGPVFTMYTTLRDGLIVTGG
KERPSKEGGALKLWDQELKRCRAFRLETGQVIDCVRSVCRGKGKILVGTRNAEIIEVGEK
NAACNILVNGHMDGPVWGLGAHPTRDVFLSAAEDGTVRLWDISQRKMLNKVNLGHPARTV
SYSPEGDMVAIGMKNGEFIILLVTSLKIWGKKRDRRSAIQDIRFSPDSRYLAVGSSENAV
DFYDLTLGPQLNRINCCRDIPSFVMQMDFSADSCFVQLSTGAYKRVVYEVPSGKQVTEQA
VIDRITWATWTSVLGDEVVGIWSRNTDKADVTCACVSHSGINIVTGDDFGMVKLFDFPCP
EKFAKHKRFLGHSAHLTNVRFTNGDRFVVSAGGDDRSLFVWRCVHTPH
Download sequence
Identical sequences ENSDARP00000100360 ENSDARP00000100360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]