SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000100510 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000100510
Domain Number 1 Region: 116-185,518-687
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.33e-40
Family Protein kinases, catalytic subunit 0.00032
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily MIT domain 1.83e-22
Family MIT domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000100510   Gene: ENSDARG00000079024   Transcript: ENSDART00000109478
Sequence length 690
Comment pep:known chromosome:Zv9:17:53083997:53104478:-1 gene:ENSDARG00000079024 transcript:ENSDART00000109478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKDYLLDAAQQIRMALDREVNEDYEAAFSYYKNGVDLLLNGVQVDPNKERREAVKRKT
TQYLKRAEEIFISYLQDNISKGSTHLGGYSSLRFRSIRHLSSPVENLAMCKVTGVIDKVL
TVESLINKETFIVKSLPKSSWESRERSTIIPQGVPFMVKLLKYYVSEDTVFLHLEHLQGG
RLFSRLHRVRSEAIREYPECFSPNQHKIYLKNSYTLPVLRQNTYLNEDYGRTSPPANHRL
ENCNPRSYCEDVGCQQTGSPSVFASDGLPSVGVPNGLNSLPQDNAPLPIHPCVIVDTRDP
LDVTSDLLGNDVRIERIDSCVDLSKAWGALEPAQDCRGFTGSNSDILGFRIAAQITPSTL
FGANAQPILCSTVNVLPQRVRIIPNASTKHQAHDGFPHEHNSPHRRPSGQQFVTEFHKVS
SNRYSFECTPQNQDGFTLEFTNITSRGNSGDLGKQDNCQFFSHSFTQPEVSMISCPSAST
TNSACWSETYLEAGHRVNVAGLESKPQINTKNVGAKAKWGRRGLPEDEVRLWGAQILLAL
ESLHEQGIVCQDLNPRNILLRSSGEACLTYFGQWTEVQPEINPKAMEEMYCAPEIGGVSK
VTEACDWWSFGALLYELLTGMPLWQCHPAGVHPHTPLHIPEFLSTAATSLLTELLQFDAC
YRLGSGGGGVSDIKCHPFFSAVPWLKLSSS
Download sequence
Identical sequences E7FF70
XP_005159002.1.45394 ENSDARP00000100510 ENSDARP00000100510 ENSDARP00000128143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]