SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101257 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101257
Domain Number 1 Region: 3-80
Classification Level Classification E-value
Superfamily HMG-box 4.19e-26
Family HMG-box 0.00000871
Further Details:      
 
Domain Number 2 Region: 83-132
Classification Level Classification E-value
Superfamily HMG-box 2.36e-16
Family HMG-box 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101257   Gene: ENSDARG00000030479   Transcript: ENSDART00000108983
Sequence length 165
Comment pep:known chromosome:Zv9:15:30810620:30814116:-1 gene:ENSDARG00000030479 transcript:ENSDART00000108983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDPRKPRGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSAKEKGKFE
DMAKQDKVRYEREMKNYIPPKGENPGLSIGDIAKKLGEMWNSSSAEVKQPYEKKAAKLKE
KYDKDIALYRTKGIAGFSKKEGGEDDEEDEDDDEEEDDEEEEDDE
Download sequence
Identical sequences A6H8T4
ENSDARP00000101257 ENSDARP00000101257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]