SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101265 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101265
Domain Number 1 Region: 14-111
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.68e-17
Family PLC-like (P variant) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101265   Gene: ENSDARG00000076313   Transcript: ENSDART00000108644
Sequence length 134
Comment pep:known chromosome:Zv9:4:7214692:7215096:-1 gene:ENSDARG00000076313 transcript:ENSDART00000108644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFTHLQLVFVAVLMLSSQLDFAKAAVVLSGLKGSNLPGDALGNKPDPYVKIWCGSSSV
VTGYFKNNANPSWDAEYYLSGCVSRNTIRLEVWDKDAKYDDRIGSYSGTVASGTNNKVSF
SVGKGTMSFKYDVK
Download sequence
Identical sequences A5WUP7
ENSDARP00000101265 ENSDARP00000112802 ENSDARP00000101265 7955.ENSDARP00000101265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]