SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101443 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101443
Domain Number 1 Region: 391-498
Classification Level Classification E-value
Superfamily Second domain of FERM 7.46e-29
Family Second domain of FERM 0.00045
Further Details:      
 
Domain Number 2 Region: 499-645
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-27
Family Third domain of FERM 0.0035
Further Details:      
 
Domain Number 3 Region: 683-789
Classification Level Classification E-value
Superfamily PDZ domain-like 1.33e-23
Family PDZ domain 0.006
Further Details:      
 
Domain Number 4 Region: 303-389
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.11e-17
Family First domain of FERM 0.0091
Further Details:      
 
Domain Number 5 Region: 852-915
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000133
Family PDZ domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000101443
Domain Number - Region: 6-149
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00121
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101443   Gene: ENSDARG00000074119   Transcript: ENSDART00000108480
Sequence length 921
Comment pep:known chromosome:Zv9:12:2796386:2832924:1 gene:ENSDARG00000074119 transcript:ENSDART00000108480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFVTLAEVLESRAAPLEEDEVWALLLGATEALIDISSKDDGNMCCVISPGSMLLSAVG
SIAFKTCSRSEDVGSFTCPEMSQSNTSSRRLASEKMVVYSLGMTLYWAVDYNLPQNQPVQ
VSDTLNSLLLSMCEDVAHRRVNLLTVLETAENHHQTAVLPRPEKTIRQMAEDVLQTEKPS
NDSAHLIDRSQMVRERLRGASSQNSVWTQKGNSTPSAADFSRFHSSHQRSRNSTYMSQSP
VLDRRRQFALRPDQLFASSFSLNERKMKDTGPEFIRMLEEPLVVLELPNSIVSNKGKSSS
NQRDLTVLMPNGQNVLLKCDVKCRGRDAFDMIVAHTNLVEHFYFGLAYSYDNEFFFLDND
TKISKVAPGDWKKVPTATFVLHFRIKYFVSDVSLLLNKFTRHQFYLQLRRDLLDDRLQCN
EETCLFLGALALQAEFGDSLPEVYGKNYYQPEHYVSKSVVQKMAMPCLKEELLRLHVNNA
NMSAEEAELEFLKSVQQLPEYGVLFHRVAREKKPVFGELLLGVCAKCITVYEVINNCRTA
SLTFHWRDTSSITSTRRKFIIECSTSKKKHVFLTEKSKVAKYLCDLCSAQHKFHKEMSSR
QLTHSLASEESIVQYAALCRAQNNEVNDSSADESMSKLCEDIATRIEAKIKLQRDLLDNT
GSQSPILQRSLCSTPKRGSDVPSVSSPLRDTPTGARTPEREIICVSLKKDPKVGLGIVIV
GEDTAGKLDLGIFIASVVPGSPADRDGRIKPGGRLISLNQLSLEGMSFSEAADIMQSSSN
DVELIISQPKAQCKRGGSVSLNERSYESQSTILADGRTGDEFLDELVSVMMTPKASNRLH
VPEVRIINAQDDYSRSASLISLRPEEFTVTLMKSGGSLGISIAGGVNTGLRYGGIYIKSL
VSGGVAEQDGRIQTGKHHCSH
Download sequence
Identical sequences ENSDARP00000101443 ENSDARP00000101443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]